KEGG   Azospirillum lipoferum: AZOLI_p10528Help
Entry
AZOLI_p10528      CDS       T01658                                 

Gene name
galM1
Definition
(GenBank) Aldose 1-epimerase (Galactose mutarotase)
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ali  Azospirillum lipoferum
Pathway
ali00010  Glycolysis / Gluconeogenesis
ali00052  Galactose metabolism
ali01100  Metabolic pathways
ali01110  Biosynthesis of secondary metabolites
ali01120  Microbial metabolism in diverse environments
ali01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZOLI_p10528 (galM1)
   00052 Galactose metabolism
    AZOLI_p10528 (galM1)
Enzymes [BR:ali01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AZOLI_p10528 (galM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CBS88779
UniProt: G7ZBM2
Position
AZO_p1:complement(513975..515054)
Genome map
AA seq 359 aa AA seqDB search
MATYTDLKRDDYRATIDGKPVDLFTLRNGRGMVVRITNYGAKIEQILVPDRDGTLGDVVQ
GYDTIDGAMGGQPSMGSFIGRYCGRIDGGRFTLDGVEHQASVNSPPNTVHGGQRGSRFRV
FDARQLDESSLELTYVFQDGEEGFPGTLPVRLVYSVGDDNALTIAWTAVAADKTTIANFT
DHTFFNLSGDLGSSILDHVATVHAGRYLALSDTAVPTGEVVDVTGTPLDFRTPAAFGDRI
DADDRMLALGKGYDLHYVIDKPASGSAPALQARILHPGSGRTLEVLSTEPGLQLYTGNFL
EGKAPRDVGKGGTLYTKHSAFCAEPSKFPNSVNIPSFPSTVLRPGQWYAGSIVYRFGVA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctacaccgacttaaagcgcgacgattaccgcgccaccatcgacggcaagccg
gtggacctgttcaccctgcgcaacggccggggcatggtggtgcggatcaccaattacggc
gccaagatcgaacagatcctggttcccgaccgcgacggcacgctgggcgacgtcgtccag
ggctatgacaccatcgatggcgcgatgggcggccagccctccatgggctccttcatcggg
cgctactgcgggcgcatcgacggcggacgcttcacgctggacggcgtggagcatcaggct
tcggtcaacagcccgcccaacaccgtgcatggcggccagcgcggttcgcgcttccgcgtc
ttcgacgcccgacagttggacgaatccagcctggagctgacctacgtcttccaggacggc
gaggaaggcttccccggcaccctgccggtgcggctggtctattcggtcggcgacgacaac
gccctgaccatcgcctggaccgctgtggcggccgacaagaccaccatcgccaacttcacc
gaccacaccttcttcaacctgtcgggcgatctcggatcgtccatcctcgaccatgtcgcc
accgtccatgccggccgctatctggcgctcagcgacaccgcggtgccgaccggcgaggtg
gtggacgtcaccggcacaccgctggacttccgtaccccggcggccttcggcgaccgcatc
gacgccgacgaccgcatgctggcgctcggcaagggctatgacctgcactatgtgatcgac
aagccggcatccggttcggcgccggcgctgcaggcccgcatcctccaccccggcagcggc
cggacgctggaggtgctgtcgaccgagcccggccttcagctctacaccggcaatttcctg
gagggcaaagccccccgcgacgtcggcaagggcggcacgctctacaccaaacacagcgcc
ttctgcgccgaaccgtcgaaattcccgaactccgtcaacattccctccttcccctcgacc
gtgctgcgccccggccaatggtatgccgggtccatcgtctaccggttcggggtggcctga

DBGET integrated database retrieval system