KEGG   Azospirillum lipoferum: AZOLI_p10550Help
Entry
AZOLI_p10550      CDS       T01658                                 

Gene name
asnB2
Definition
Asparagine synthase, glutamine-hydrolyzing
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ali  Azospirillum lipoferum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AZOLI_p10550 (asnB2)
Enzymes [BR:ali01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     AZOLI_p10550 (asnB2)
Peptidases [BR:ali01002]
 Cysteine Peptidases
  Family C44
   AZOLI_p10550 (asnB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p1:complement(532082..534136)
Genome map
AA seq 684 aa AA seqDB search
MCGVAGVLAGSHAEPPGLDELKRMIAMLGHRGPDGYGFYRDDRIGLAHARLSIVGLAGGF
QPIHNEDRTLWISFNGEIFNHVELRRDLEARGHRFYTRTDTEVIVHAFEEYGPATWAMLN
GQFAICLWDSKRRELWLVRDRLGILPLFYARRGDHLVFASEAKALFGGGRVTPAFDPARL
AQVFTHWSTAPHGSVFAGVESVPAATAIRVDSALALHVDRYWQPDFAADPSLAKLSLDEA
ADRLEEKLLDAIRLRLRADVPVGVYISGGLDSSVIAALARKLDTTHMHSFGVRFTDAGFD
ETPQQRLVAGHVGTEHHDILCSPQDIQSALPDVIRHGETPLVRTAPAPLFLLSRLVRECG
IRVVLSGEGADEWLAGYDIFKEDKVRRFWARQPDSKARPKLLGRVHPFAAVNGQKDSPLW
QAFFKRGMMDTEETFYAHRTRWRNTAWSQRLLSADVQAAADDAAFEAHVAAHLPDGWSRW
SPLARSQWAEIATFMTPYLLSAQGDRVAMANGIEVRYPFLDPAVDDLCAALPDRVKMLGL
RDKLALRRLAARHLPAEIFQRPKRPYRAPMTTALFGDGAPDYVRDLLSPEALARYGLTDA
DAVSALADKAHRQNGRMTGEREEMALVGTLTLQLLAHYVHDELPQRIRDQRAALDRAEIH
VLEDRALKDRDADARTVTPQPTAA
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtgtcgccggagttctcgcaggatcgcatgccgaaccgcccggtctggacgag
ctgaagcgcatgatcgccatgctgggccaccgcggtccggacggctacggcttctatcgt
gacgaccggatcgggcttgcccatgcgcggctcagcatcgtcggcctcgccggcggcttc
cagccgatccacaacgaggaccgcaccctctggatcagcttcaacggcgagatcttcaac
catgtcgaattgcggcgggatctggaggcgcgcggccaccgcttctacacccgaaccgac
accgaggtgatcgtccacgccttcgaggaatacggccccgccacctgggccatgctgaac
ggccagttcgccatctgcctgtgggacagcaagcggcgcgagctgtggctggtccgcgac
cggctgggcatcctgccgctgttctatgcgcggcgcggcgatcatctggtcttcgcgtcg
gaggccaaggccctgttcggcggcggccgggtgacgcccgccttcgacccggcccgtctc
gcccaggtcttcacccattggagcaccgcgccgcatggcagcgtgttcgccggggtggag
agcgtgccggcggccaccgccatccgcgtcgactccgcccttgccctgcatgtcgaccgc
tactggcaacccgacttcgccgccgatccctcgctcgccaagctgtcgctggacgaggcg
gccgaccggctggaggagaagctgctcgacgccatccgcctgcggctgcgcgccgatgtg
ccggtcggcgtctacatcagcggtgggctcgacagctcggtgatcgccgcgctggcccgc
aagctcgacaccacccacatgcacagcttcggcgtccgcttcaccgatgccggcttcgac
gagacgccgcagcagcggctggtcgccggccatgtcgggaccgagcatcacgacatcctc
tgcagcccgcaggacatccagtcggcattgcccgatgtcatccgccacggcgagacgccg
ctggtccgcaccgcccccgccccgctgttcctgctgtcgcgtctggtgcgcgagtgcggc
atccgcgtcgtgctgtccggcgagggcgccgacgagtggctggccggctacgacatcttc
aaggaggacaaggtccgccgcttctgggcgcgccagcccgacagcaaggcgcggccgaag
ctgctgggccgcgttcatcccttcgctgccgtcaacggccagaaggacagcccgctgtgg
caggccttcttcaagcgcgggatgatggatacggaggagaccttctacgcccaccgcacc
cgctggcggaacaccgcatggtcgcagcgcctgttgtccgccgatgttcaggccgccgcc
gacgatgccgccttcgaggcgcatgtggcggcccatctgccggacggctggtcgcgctgg
tcgccgctggcgcgcagccaatgggcggaaatcgccaccttcatgaccccctatctgctg
tcggcgcagggcgaccgcgtcgccatggccaacggcatcgaggtccgctatcccttcctc
gacccggcggtcgacgacctctgcgcagcattgccggaccgggtgaagatgctgggactg
cgcgacaagctggccctgcgccggctcgccgcccgccatctgcccgccgagatctttcag
cggccgaagcgcccctaccgcgcgccgatgaccaccgccctgttcggcgacggcgccccg
gactatgtccgcgacctgctgtcgccggaagcactcgcccgctacggcctgaccgacgcc
gacgccgtctccgccctggccgacaaggctcaccgccagaacggccgcatgaccggcgag
cgggaggagatggcgctggtcggcaccctgaccctgcagttgctggcccattacgtccat
gacgagcttccccagcgcatccgcgaccagcgggccgccctggaccgtgccgaaatccac
gtgctggaagaccgggcattgaaagatcgggatgccgacgcccggaccgtcacgccacag
cccactgcggcctga

DBGET integrated database retrieval system