KEGG   Azospirillum lipoferum 4B: AZOLI_p10561Help
Entry
AZOLI_p10561      CDS       T01658                                 

Definition
Putative endoglucanase (Cellulase)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ali  Azospirillum lipoferum 4B
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ali00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p1:complement(547576..550095)
Genome map
AA seq 839 aa AA seqDB search
MATNPVDMTFVVNASGVAAGGVWPHFKFLVDGVSVGQATVNSTSPGRYSFTTKVAPDAAH
KVQVVYDNDWLSTDKTGMYRDLIVKSIEVNGKTIASNSSTVSYAAEGQGTLSGREILSWS
GSLDFNMSKDVFAGAAGTPTTPTPTPPATGGTPIVVNAYGNAAGGVNAHFKVLVDGKVIG
EATAGTAAKDFTFNANVSADMAHKVQIQFDNDGVVNGADRNLYVNKITIGGHAVAPTDSI
VSIDKGALDGKDIVAGQKAMWWNSTMEVKADQSWFAGATTPTPNPSNPSQPSLSVSDVSV
AEPTGNTSSGGIQGFLSTKGNQIVDEAGNAVRLTGINWFGGEGYNYVPAGLWADSYQGHL
EKMKSVGFNTIRLTMSDEMFTSSAVTNGIDYSKNPDLVGLTRLQVYDKVIEHAGKLGMKV
ILDHHRNDGGAGTNEHGLWYSNRFPESTVIENWKMLAKHYAGNETVIGADLHNEPSVTAT
WGGSAATDWASAAERIGNAIQSVNKDWLLFVEGTEWSSTLAGAQSRPIEFDTPNKLVYSP
HAYGHSVGNFSWLNDPAYPNNLPAQYDKMWGYLYKNDTAPILLGEWGGLFNSSAEQTWAR
TMGKYLNGDWNLDGKSDIAAGDKGMSWTFWAWTPESGDVGGILMDDYKTINQSKINLIKP
AMEGAVFDTPGGSSTPNTANATFTVKLSSASGTPVTVDYATVDGTAKAGSDYTATSGKLT
FAAGETTKTVTVKVLSDSVTEGNETFGLKISNSTAATIADATGTGTIVSAAAKAAAASLD
SADLLAHTMTTANDPATAGDLSAAALASQDAFAADLSYANLGVNYHELHTTDGSLAHAA
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgaaccccgtcgatatgaccttcgtcgtcaatgcctcgggtgtggctgccgga
ggagtctggccgcatttcaagttcctcgtcgacggcgtctccgttggccaggcgacggtc
aattccaccagcccgggccggtacagcttcaccaccaaggtggcgccggacgccgcgcac
aaagtccaggtcgtgtatgacaacgactggctgtcgaccgacaagaccggcatgtaccgc
gatctgatcgtcaagtcgattgaagtcaacggcaagaccatcgcttccaacagctcgacg
gtctcctacgccgctgagggccagggcaccctgtccggccgcgaaattctgtcctggagc
ggctcgctcgacttcaacatgtccaaggacgtgttcgccggcgccgccgggaccccgacc
acccccacccccacccccccggccaccggcggcacgccgatcgtcgtgaacgcctacggc
aatgcggccggcggcgtgaacgcccacttcaaggtgctggtcgacggcaaggtgatcggt
gaagccaccgccggcaccgccgcgaaggacttcaccttcaacgccaacgtcagcgccgac
atggcccacaaggtccagatccagttcgacaacgacggcgtggtcaacggcgccgaccgc
aacctgtatgtcaacaagatcaccatcggcggccacgccgtcgccccgaccgacagcatc
gtgtccatcgacaagggtgccctggacggcaaggacatcgtcgccggccagaaggcgatg
tggtggaacagcaccatggaggtgaaggccgaccagtcctggttcgccggtgccaccacg
ccgacgccgaacccgtccaacccgtcgcagccgagcctgtcggtcagcgacgtgtcggtg
gccgagccgaccggcaacacctcctccggcggcatccagggcttcctgagcaccaagggc
aaccagatcgtcgacgaggccggcaacgcggttcgcctgaccggcatcaactggttcggc
ggcgagggctacaactatgtgcccgccggcctgtgggccgacagctaccagggccatctg
gaaaagatgaagtcggtcggcttcaacaccatccgcctgaccatgtcggacgagatgttc
accagctcggcggtgaccaacggcatcgactattcgaagaacccggatctggtcggcctg
acccgtctgcaggtctatgacaaggtcatcgagcatgccggcaagctcggcatgaaggtg
atcctcgaccaccaccgcaacgacggcggcgccggcaccaacgaacatgggctgtggtac
agcaaccgcttcccggaatcgacggtgatcgagaactggaagatgctggccaagcattat
gccggcaacgagaccgtcatcggcgccgacctgcacaacgagccgagcgtcacggccacc
tggggcggcagcgccgccaccgactgggcctcggccgcggagcgcatcggcaacgccatc
cagtccgtcaacaaggattggctgctgttcgtcgaaggcacggagtggagcagcacgctg
gccggtgcgcagtcgcgccccatcgagttcgacacccccaacaagctcgtctactcgccg
catgcctacggccacagcgtcggcaacttcagctggctgaacgatccggcctatccgaac
aacctgccggcccagtacgacaagatgtggggctacctgtacaagaacgacaccgcgccg
atcctgctcggcgaatggggtggcctgttcaacagctcggccgagcagacctgggcccgg
accatgggcaagtacctgaacggcgactggaacctggacggcaagagcgacatcgccgcc
ggcgacaagggcatgagctggaccttctgggcctggacgccggaatccggtgacgtgggc
ggcatcctgatggacgactacaagaccatcaaccagtcgaagatcaacctgatcaagccg
gccatggaaggcgccgtcttcgacacccccggcggctccagcacgccgaacaccgccaac
gccaccttcacggtgaagctgtcgtcggcctccggcaccccggtcacggtggattacgcc
acggtggacgggacggccaaggccggttcggactacaccgccaccagcggcaagctgacc
ttcgccgccggcgagaccaccaagaccgtcacggtcaaggtgctgagcgacagcgtgacg
gaaggcaacgagaccttcggcctgaagatctccaactcgaccgccgcgaccatcgccgac
gccaccggcaccggcacgatcgtctcggccgccgccaaggccgccgccgcatcgctggac
tcggccgacctgctggcccacacgatgacgaccgccaacgacccggcaaccgccggcgac
ctgtcggcggcggcgctcgccagccaggacgcgttcgccgcggacctgtcctatgccaac
ctgggcgtgaactaccacgagctgcacacgaccgacggcagcctggcccacgccgcctga

DBGET integrated database retrieval system