KEGG   Azospirillum lipoferum: AZOLI_p10567Help
Entry
AZOLI_p10567      CDS       T01658                                 

Gene name
gpmA
Definition
(RefSeq) Phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ali  Azospirillum lipoferum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZOLI_p10567 (gpmA)
   01230 Biosynthesis of amino acids
    AZOLI_p10567 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZOLI_p10567 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    AZOLI_p10567 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AZOLI_p10567 (gpmA)
Enzymes [BR:ali01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AZOLI_p10567 (gpmA)
Exosome [BR:ali04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AZOLI_p10567 (gpmA)
  Exosomal proteins of melanoma cells
   AZOLI_p10567 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p1:complement(559297..560058)
Genome map
AA seq 253 aa AA seqDB search
MHRLILLRHGQSVWNAEDRFTGWTDVGLTDRGVAETRQAAELLKAAGIDVDVAFTSVLSR
AIETLHLVLRDMDRLWLPVHKHWRLNERHYGTLQGLNKAETAERHGAEQVFQWRRSWDIP
PPPIEPDDPRSAVADRRYAGLARSNLPRGESLKDTTARVVPFWSEAISPALRLGARVLVS
AHGNSLRGLVKHLDNVADRDIPLFEIPTSRPLVYELGADLTPLRRYFLGENGAVEEITWP
TREGTGGSSSAAA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgactgatcctgctgcgccatggccagagcgtctggaatgccgaggaccgcttc
accggatggaccgacgtcgggctgaccgaccgtggcgtcgccgagacccgtcaggcggcg
gaattgctgaaggccgccggcatcgacgtcgacgtcgccttcacctcggtgctgagccgc
gccatcgagacgctgcacctcgtcctgcgcgacatggaccggctgtggctgccggtgcac
aagcattggcgcctgaacgaacggcattacggcacgttgcagggattgaacaaggcggag
acggcggaacgccacggggccgagcaggtgttccagtggcggcgcagctgggacatcccg
ccgccaccgatcgagccggacgacccgcgctccgccgtcgccgaccgccgctatgccgga
ctggcgcggtcgaacctgccgcgcggcgaaagcctgaaggacaccaccgcccgcgtcgtt
cccttctggagcgaggcgatcagcccggcgctgcggctgggcgcccgcgtgctggtgtcg
gcgcacggcaacagcctgcgcgggctggtcaagcatctggacaacgttgccgaccgggac
atcccgctgttcgagatccccaccagccgccccctggtctatgaactgggcgccgacctg
acgccgctgcgccgctacttcctgggcgagaacggagcggtggaggagatcacttggccg
acccgggaagggaccggcgggagcagcagcgcggcagcgtaa

DBGET integrated database retrieval system