KEGG   Azospirillum lipoferum: AZOLI_p10640Help
Entry
AZOLI_p10640      CDS       T01658                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ali  Azospirillum lipoferum
Pathway
ali00010  Glycolysis / Gluconeogenesis
ali00620  Pyruvate metabolism
ali00640  Propanoate metabolism
ali00680  Methane metabolism
ali01100  Metabolic pathways
ali01110  Biosynthesis of secondary metabolites
ali01120  Microbial metabolism in diverse environments
ali01130  Biosynthesis of antibiotics
ali01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZOLI_p10640
   00620 Pyruvate metabolism
    AZOLI_p10640
   00640 Propanoate metabolism
    AZOLI_p10640
  Energy metabolism
   00680 Methane metabolism
    AZOLI_p10640
Enzymes [BR:ali01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AZOLI_p10640
Lipid biosynthesis proteins [BR:ali01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AZOLI_p10640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CBS88870
UniProt: G7ZAN0
Position
AZO_p1:650610..652226
Genome map
AA seq 538 aa AA seqDB search
MLPNADSYDGVSRAFAWRVPDRYNIGVDVCDRWAESEPDRIALINKRRDGGVEEYRFADI
RALSNRFANALAAQGIGRGDRVGILLPQAPETAISHVAVYKLGGIAVPLFSLFGVEALEY
RLANCGARAVVTDAAGAAKIAQIRDRLPELRAVFRIDGSGANCLDWHALCDAASDDFAPA
DTGPDDPALIIYTSGTTGQPKGALHAHRVLLGHLPGVEMSHDLFPQPGDRIWTPADWAWI
GGLLDVLLPAWHHGVTVVSHRFEKFDAEAAFALLAEFRVRNAFLPPTALKMMRSVTAPRA
RHAIAMRSVASGGETLGAGMLDWGRETFGVTINEFYGQTECNMIVSSAATLMAPKPGIMG
RPVPGHDVAVIDGEGNRLPPERIGLIAVRRPDPVMFLGYWNNPGATAAKFIGDWLVTGDQ
GELDEDGYIRFVGRDDDVITSAGYRIGPGEIEDCLIGHPAVRMAAVVGVPDPLRTEIVKA
FIVLQEGVTADDALVAAIQDHVKTRLAAHEYPRAIEFLESLPMTTTGKIIRRELRNRP
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccaacgcggacagctatgacggggtgtcccgcgccttcgcctggcgcgtcccc
gaccgctacaacatcggagtcgacgtctgcgaccgctgggcggagtccgagccggaccgc
atcgccctgatcaacaagcggcgcgacggcggggtggaggaataccgcttcgccgacatc
cgcgccctgtccaaccgcttcgccaatgcgctcgccgcccagggcatcggccgcggcgac
cgggtcggcatcctgctgccccaggcaccggaaaccgcaatcagccatgtcgccgtctac
aagctgggcggcatcgcggtgccgctgttctcgctgttcggggtggaggcgctggagtac
cggctggccaattgcggcgcccgcgccgtggtcaccgatgcagccggcgccgcgaagatc
gcccagatccgcgaccgcctgccggagttgcgcgccgtcttccgcatcgacgggtcgggg
gccaactgcctcgactggcatgcgctgtgcgacgcggcgtcggacgacttcgccccggcc
gacaccggtcccgacgatccggccctgatcatctacacctccggcaccaccggccagcca
aagggggcgctgcatgcgcaccgggtgctgctgggccatctgccgggcgtggagatgtcg
cacgacctgttcccgcagccgggcgaccgcatctggacgccggcggactgggcgtggatc
ggcgggctgctcgacgtgctgctgccggcctggcaccacggggtgacggtcgtctcccac
cggttcgagaagttcgatgcggaggccgccttcgccctgctggccgagttccgggtgcgc
aacgccttcctgccgccgacggcgctgaagatgatgcggtcggtaacggcgccgcgggca
cgccacgccatcgccatgcgctccgtcgccagcggcggcgagaccttgggcgccgggatg
ctcgactggggacgggagactttcggcgtcaccatcaacgagttctacggccagaccgaa
tgcaacatgatcgtctcctcggcagccacgctgatggcgccgaagccgggcatcatgggc
cgaccggttcccggccatgacgtggcggtgatcgacggggagggcaaccgcctgccgccg
gaacggatcgggctgatcgcggtgcgccggccggacccggtgatgttcctcggctactgg
aacaacccgggcgccaccgcggcgaaatttatcggcgactggctggtcaccggcgaccag
ggggaactggacgaggacggctacatccgcttcgtcgggcgcgatgacgatgtcatcacc
tcggccggctaccgcatcggtcccggcgagatcgaggattgcctgatcggccatcccgcc
gtccgcatggcggcggtggtcggcgtgcccgacccgctgcgcaccgagatcgtcaaggcc
ttcatcgtgctgcaggagggggtaacggcagacgacgcgctggtcgccgcgatccaggac
catgtgaagacgcggttggccgcccacgaatatccgcgcgcaatcgaatttctcgaaagc
ctgcccatgaccaccaccggcaagatcattcgccgggagttgaggaatcgtccctaa

DBGET integrated database retrieval system