KEGG   Azospirillum lipoferum: AZOLI_p10640Help
Entry
AZOLI_p10640      CDS       T01658                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ali  Azospirillum lipoferum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZOLI_p10640
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZOLI_p10640
   00620 Pyruvate metabolism
    AZOLI_p10640
   00640 Propanoate metabolism
    AZOLI_p10640
  Energy metabolism
   00680 Methane metabolism
    AZOLI_p10640
Enzymes [BR:ali01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AZOLI_p10640
Lipid biosynthesis proteins [BR:ali01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AZOLI_p10640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p1:650610..652226
Genome map
AA seq 538 aa AA seqDB search
MLPNADSYDGVSRAFAWRVPDRYNIGVDVCDRWAESEPDRIALINKRRDGGVEEYRFADI
RALSNRFANALAAQGIGRGDRVGILLPQAPETAISHVAVYKLGGIAVPLFSLFGVEALEY
RLANCGARAVVTDAAGAAKIAQIRDRLPELRAVFRIDGSGANCLDWHALCDAASDDFAPA
DTGPDDPALIIYTSGTTGQPKGALHAHRVLLGHLPGVEMSHDLFPQPGDRIWTPADWAWI
GGLLDVLLPAWHHGVTVVSHRFEKFDAEAAFALLAEFRVRNAFLPPTALKMMRSVTAPRA
RHAIAMRSVASGGETLGAGMLDWGRETFGVTINEFYGQTECNMIVSSAATLMAPKPGIMG
RPVPGHDVAVIDGEGNRLPPERIGLIAVRRPDPVMFLGYWNNPGATAAKFIGDWLVTGDQ
GELDEDGYIRFVGRDDDVITSAGYRIGPGEIEDCLIGHPAVRMAAVVGVPDPLRTEIVKA
FIVLQEGVTADDALVAAIQDHVKTRLAAHEYPRAIEFLESLPMTTTGKIIRRELRNRP
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccaacgcggacagctatgacggggtgtcccgcgccttcgcctggcgcgtcccc
gaccgctacaacatcggagtcgacgtctgcgaccgctgggcggagtccgagccggaccgc
atcgccctgatcaacaagcggcgcgacggcggggtggaggaataccgcttcgccgacatc
cgcgccctgtccaaccgcttcgccaatgcgctcgccgcccagggcatcggccgcggcgac
cgggtcggcatcctgctgccccaggcaccggaaaccgcaatcagccatgtcgccgtctac
aagctgggcggcatcgcggtgccgctgttctcgctgttcggggtggaggcgctggagtac
cggctggccaattgcggcgcccgcgccgtggtcaccgatgcagccggcgccgcgaagatc
gcccagatccgcgaccgcctgccggagttgcgcgccgtcttccgcatcgacgggtcgggg
gccaactgcctcgactggcatgcgctgtgcgacgcggcgtcggacgacttcgccccggcc
gacaccggtcccgacgatccggccctgatcatctacacctccggcaccaccggccagcca
aagggggcgctgcatgcgcaccgggtgctgctgggccatctgccgggcgtggagatgtcg
cacgacctgttcccgcagccgggcgaccgcatctggacgccggcggactgggcgtggatc
ggcgggctgctcgacgtgctgctgccggcctggcaccacggggtgacggtcgtctcccac
cggttcgagaagttcgatgcggaggccgccttcgccctgctggccgagttccgggtgcgc
aacgccttcctgccgccgacggcgctgaagatgatgcggtcggtaacggcgccgcgggca
cgccacgccatcgccatgcgctccgtcgccagcggcggcgagaccttgggcgccgggatg
ctcgactggggacgggagactttcggcgtcaccatcaacgagttctacggccagaccgaa
tgcaacatgatcgtctcctcggcagccacgctgatggcgccgaagccgggcatcatgggc
cgaccggttcccggccatgacgtggcggtgatcgacggggagggcaaccgcctgccgccg
gaacggatcgggctgatcgcggtgcgccggccggacccggtgatgttcctcggctactgg
aacaacccgggcgccaccgcggcgaaatttatcggcgactggctggtcaccggcgaccag
ggggaactggacgaggacggctacatccgcttcgtcgggcgcgatgacgatgtcatcacc
tcggccggctaccgcatcggtcccggcgagatcgaggattgcctgatcggccatcccgcc
gtccgcatggcggcggtggtcggcgtgcccgacccgctgcgcaccgagatcgtcaaggcc
ttcatcgtgctgcaggagggggtaacggcagacgacgcgctggtcgccgcgatccaggac
catgtgaagacgcggttggccgcccacgaatatccgcgcgcaatcgaatttctcgaaagc
ctgcccatgaccaccaccggcaagatcattcgccgggagttgaggaatcgtccctaa

DBGET integrated database retrieval system