KEGG   Azospirillum lipoferum: AZOLI_p10735Help
Entry
AZOLI_p10735      CDS       T01658                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
ali  Azospirillum lipoferum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AZOLI_p10735
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZOLI_p10735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p1:746610..747002
Genome map
AA seq 130 aa AA seqDB search
MHAKLSPHRWVMLLLLLSIPVSPFTRKSAAAEGETLFRQQCGACHTVKKDDGPRAGPPLF
GVIGRKAGSAAGFEYSDALRGAGFAWDAGHLERWLANSNEFLPGSYMNYRQDDGSVRKSI
VNFLETSATR
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcgaaactgtcgccgcaccgctgggtgatgctgctgctcctgctgtccataccg
gtctcgcccttcacgcggaaatccgcggcggcggaaggcgagacgctgttccggcagcaa
tgcggagcctgccatacggtgaagaaggacgacggcccgcgcgccggaccaccgctgttt
ggcgtcatcggccgcaaggccggctcggcggccggcttcgaatactccgacgcgttgcgc
ggcgccggcttcgcctgggacgccggccatctggaacgctggctggcgaattcgaacgaa
ttcctcccaggcagctacatgaattaccggcaggacgacggcagcgtccgcaagagcatc
gtcaatttcctcgaaaccagcgcaacccgctga

DBGET integrated database retrieval system