KEGG   Azospirillum lipoferum: AZOLI_p10769Help
Entry
AZOLI_p10769      CDS       T01658                                 

Gene name
nagZ
Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ali  Azospirillum lipoferum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AZOLI_p10769 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    AZOLI_p10769 (nagZ)
Enzymes [BR:ali01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AZOLI_p10769 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p1:complement(774510..775592)
Genome map
AA seq 360 aa AA seqDB search
MGHRPAGSITPVVHPRAVVFGCAGLEVTPDEAAFFRDADPLGFILFRRNCDSRDQMRRLV
DDLRASVGRPDAPVLIDQEGGRVARMRPPHWPAHPPMGVFGALAGRDADAGREAAQEAAR
EAAWINGRLLAHMLAEVGITVDCAPVCDVPVEGAHDIIGDRAFSRDPAVVIALARATAEG
LLAGGVLPVLKHIPGHGRAFADSHAELPVVEADRAVLEATDFAPFRALADLPLAMVAHVV
LKAIDPTAPASTSPIVVREVVRGPSIGFGGLLFSDDLSMNALQGDPRKRAEAVLAAGMDV
VLHCNGELDEMRSLLGAVPVLSGAAAERWARAEAMRHAPEPADIAALTNRLAELLGPAQT
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgggccatcggcctgcgggctccatcaccccggtcgtccatccgcgcgcggtcgtcttc
ggctgcgccgggctggaggtgacgcccgacgaggcggccttcttccgcgatgccgatccg
ctcggctttatcctgttccgccgcaactgcgacagccgcgatcagatgcgccggctggtc
gacgacctgcgcgccagcgtcggccggccggatgctcccgtcctgatcgaccaggagggc
ggccgggtcgcgcgcatgcgcccgccgcactggccggcccatccgccgatgggcgtgttc
ggcgcgctggccgggcgcgatgccgacgccgggcgcgaagcggcccaagaggctgcccga
gaggccgcctggatcaacggccggctgctcgcccatatgctggcggaggtcggcatcacg
gtggattgcgcgcctgtgtgcgatgtcccggtggagggggcgcacgacatcatcggcgac
cgcgccttctcgcgcgatcccgccgtggtgatcgcgctggcccgcgccaccgccgaaggg
ctgctggccggcggcgtgctgccggttctcaagcacatccccggccatggccgggccttc
gccgacagccatgccgagctgccggtggtggaggccgaccgcgcggtgctggaggccacc
gacttcgcccccttccgcgcgctggccgatttgccgctggcaatggtggcgcatgtggtt
ctgaaggccatcgacccgaccgcaccggccagcacgtcgcccatcgtggtgcgcgaggtg
gtgcgggggccgtccatcggtttcggcgggctgctgttcagcgacgatctgtcgatgaac
gcgctgcagggcgatccgcgcaagcgggcggaagcggtgctggcggcgggcatggatgtc
gtgctccactgcaatggcgaacttgacgagatgcggtcgctgctcggcgccgttccggtg
ctgagcggtgccgcggcggagcgctgggcgcgggccgaggcgatgcgccatgcgccggaa
cccgcggacatcgcggcattgacgaaccggctggccgagcttctcggcccggcccagacc
tga

DBGET integrated database retrieval system