KEGG   Azospirillum lipoferum: AZOLI_p10810Help
Entry
AZOLI_p10810      CDS       T01658                                 

Gene name
folK
Definition
7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ali  Azospirillum lipoferum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AZOLI_p10810 (folK)
Enzymes [BR:ali01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     AZOLI_p10810 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p1:805829..806350
Genome map
AA seq 173 aa AA seqDB search
MAELTPTPSSPVTVHLALGGNMGDRAANLAEAIRRLGEAVEIDAQSALYETAPMYVTDQP
AFLNMAVRGTTRLDPRALLRFIKDIESTLGRDLGGLRFGPRPIDIDILLYEDRVLTEPEL
EIPHPRMVERAFVLCPLADIAADVLHPVLNRRIDALRDEVPGRETVLRIAEGL
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcttacgcctaccccctcctctcccgtcaccgtccatctggcgctgggcggc
aacatgggcgaccgcgccgccaatctggcggaagcgatccgccggctgggcgaggcggtg
gagatcgatgcgcagtcggccctctacgagacggcgccgatgtatgtgacggaccagccg
gccttcctcaacatggcggtgcgcggcaccacccggctggacccgcgggcgctgcttcgc
ttcatcaaggacatcgagtcgacgcttggccgcgatctgggcgggcttcgcttcggcccg
cgccccatcgacatcgacatcctgctctatgaagaccgggtgctgaccgaacctgagctg
gaaatcccccacccccgcatggtggagcgcgccttcgtcctctgtccgctggccgacatc
gccgccgatgtcctgcatccggtgctgaaccgccgcatcgatgcgctgcgcgacgaggtg
ccggggcgcgagaccgtgctgcggatcgccgaagggctctga

DBGET integrated database retrieval system