KEGG   Azospirillum lipoferum 4B: AZOLI_p10810Help
Entry
AZOLI_p10810      CDS       T01658                                 

Gene name
folK
Definition
7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ali  Azospirillum lipoferum 4B
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ali00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p1:805829..806350
Genome map
AA seq 173 aa AA seqDB search
MAELTPTPSSPVTVHLALGGNMGDRAANLAEAIRRLGEAVEIDAQSALYETAPMYVTDQP
AFLNMAVRGTTRLDPRALLRFIKDIESTLGRDLGGLRFGPRPIDIDILLYEDRVLTEPEL
EIPHPRMVERAFVLCPLADIAADVLHPVLNRRIDALRDEVPGRETVLRIAEGL
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcttacgcctaccccctcctctcccgtcaccgtccatctggcgctgggcggc
aacatgggcgaccgcgccgccaatctggcggaagcgatccgccggctgggcgaggcggtg
gagatcgatgcgcagtcggccctctacgagacggcgccgatgtatgtgacggaccagccg
gccttcctcaacatggcggtgcgcggcaccacccggctggacccgcgggcgctgcttcgc
ttcatcaaggacatcgagtcgacgcttggccgcgatctgggcgggcttcgcttcggcccg
cgccccatcgacatcgacatcctgctctatgaagaccgggtgctgaccgaacctgagctg
gaaatcccccacccccgcatggtggagcgcgccttcgtcctctgtccgctggccgacatc
gccgccgatgtcctgcatccggtgctgaaccgccgcatcgatgcgctgcgcgacgaggtg
ccggggcgcgagaccgtgctgcggatcgccgaagggctctga

DBGET integrated database retrieval system