KEGG   Azospirillum lipoferum: AZOLI_p20179Help
Entry
AZOLI_p20179      CDS       T01658                                 

Gene name
rsbK
Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ali  Azospirillum lipoferum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AZOLI_p20179 (rsbK)
Enzymes [BR:ali01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AZOLI_p20179 (rsbK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p2:complement(167207..168118)
Genome map
AA seq 303 aa AA seqDB search
MIVVFGSINLDMIFAMDDLPGAGQTLLARSLELHPGGKGANQAVAAAREGAAVTMAGAVG
GDGLKETALSGLRSAGVELSRVAVTDRATGTAAVCTDAAGRNQIVVAGGANLQARAAQVE
DALLSPGTTLLVQMESDPGETTALILRARRLGARVILNLAPAAPLPLPVLKAVDILVMNE
DEAAWLGARLGCGGDAPSLHGVLGGTVIRTLGGDGVEWSSTDGSGHRPAPAVAVRDTTGA
GDCFVGVLAAQLDRGQPLAAAIRRAAGAASLSCTRAGGQASLPTAAETDAALVRSVAGGL
AVV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgattgtcgtcttcggatcgatcaacctcgacatgatcttcgcgatggacgatctgccc
ggcgccggccagacccttctggcacggtcgctggagctacatcccggcggcaagggtgcg
aaccaggcggtagccgccgcccgcgagggtgccgccgtgaccatggccggcgcggtcggc
ggcgacgggctgaaggaaactgcgctgagcggtctgcgcagcgccggggtcgagctgtcc
cgcgtggccgtgaccgaccgcgcgaccggcaccgccgccgtctgcaccgacgcggcgggc
cgcaaccagatcgtcgtcgccggtggggccaacctgcaggcgcgcgccgctcaggttgag
gatgcgctgctctcccccggcaccaccctgctggtgcagatggagtccgatcccggcgag
accacggcgctgatcctgcgtgcccgccggctcggcgcgcgggtcatcctgaacctcgcc
ccggcggccccgctgccgctgccggtactcaaggccgtcgacatcctggtgatgaacgag
gacgaggcggcgtggctgggtgcccgtctgggatgcggcggcgacgcgccgtcgctccat
ggcgtgctgggcggcacggtcatccgcacgctgggcggcgacggtgtcgaatggtcgtcg
accgacggcagcgggcatcggccggcccccgcagtcgccgtgcgcgacaccaccggggcc
ggcgattgcttcgtcggggtcctggcggcccagctcgaccgtgggcagccgctggctgca
gcgatccgccgcgccgccggcgccgcctcgctgtcctgcacgcgggccggcggacaggcc
agcctgccgaccgcggcggaaaccgacgcggcacttgtcaggtcggtggccggtgggctg
gccgtcgtctga

  All links  
No link information was found.   
DBGET integrated database retrieval system