KEGG   Azospirillum lipoferum 4B: AZOLI_p20521Help
Entry
AZOLI_p20521      CDS       T01658                                 

Gene name
arcA
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ali  Azospirillum lipoferum 4B
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ali01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ali00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p2:complement(511236..512186)
Genome map
AA seq 316 aa AA seqDB search
MSYQKTKTKQCRLVGVPVQDGAGRLGCEMGPSAYRTAGIARALSKLGHSVTDLGNVAPVP
QRPMAHGNAALKLLPEVAGWTAALSKVAYEASAGQDAMPIFMGGDHCLAAGTLTGLAQRA
AEMGRPLFVLWLDAHPDFHTLETTESGNLHGVPMAYATGRAGFDGYFPPAPAWLDPHNVC
MMGIRSVDPAERRALETSGITVHDMRKIDEHGIVSLLRPFLERVVEADGLLHVSLDVDFL
DPGIAPGVGTTVPGGATFREAHLVMEMLHDTGMVSSVDLVELNPFLDERGRTAILMVELL
ASLMGRRVLDYPTRSF
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtcctaccaaaagacaaagacgaagcagtgccggctggtcggcgtgccggtgcaggat
ggggcgggccgcctcggctgcgagatggggccgagcgcctaccgcacagccgggatcgcg
cgggcgctgtccaagctggggcacagcgtcaccgacctcggcaacgtggcgccggtgccg
cagcggccgatggcgcacggcaacgccgcgctgaagctgctgccggaggtggcgggctgg
accgccgcgctgtccaaagtggcctacgaggcgagcgccgggcaggacgccatgccgatc
ttcatgggcggcgaccactgccttgccgccggcaccctgaccggcctggcgcagcgcgcc
gccgagatggggcgcccgctgttcgtgctgtggctggacgcgcaccccgatttccacacg
ctggagacgacggagagcggcaacctgcatggtgtgccgatggcctatgccaccggccgc
gccggcttcgacggctatttcccgccggcgccggcgtggctcgatccccacaatgtctgc
atgatgggcatccgcagcgtcgatccggccgaacggcgggcgctggagacgtccggcatc
accgttcacgacatgcggaagatcgacgagcatgggatcgtctccctgctgcgtccgttt
ctggagcgggtggtggaggcggacgggttgctgcatgtcagcctggatgtcgatttcctc
gatcccggcatcgcgcccggcgttggcaccacggttcccggcggggcgaccttccgcgag
gcgcatctggtgatggagatgctgcacgacaccggcatggtcagcagcgtcgatctggtg
gagctgaaccccttcctggacgagcgcgggcgcaccgcgatcctgatggtggagttgctg
gcgagcctgatggggcgccgcgtcctcgactacccgacccgcagcttctga

DBGET integrated database retrieval system