KEGG   Azospirillum lipoferum: AZOLI_p20536Help
Entry
AZOLI_p20536      CDS       T01658                                 

Gene name
aor1
Definition
Aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
ali  Azospirillum lipoferum
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZOLI_p20536 (aor1)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AZOLI_p20536 (aor1)
Enzymes [BR:ali01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     AZOLI_p20536 (aor1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p2:complement(524559..526364)
Genome map
AA seq 601 aa AA seqDB search
MHGWIGKILRVDLGTGKITTEALKPDLARDYIGARGLGTKYMYDEVDPTVDPLSPANKLI
FASGPMTGTFAPSAGRYDVVTKGPLTGTIAASNSGGAWGPELKYAGYDMLILEGRAAKPV
YLWIQDDKVEIRDAAHLWGKDVPETTEALNEETAADAKIACIGPAGEKLSYIASIMNDMQ
RAAGRTGVGAVMGSKNLKAVVVRGTGAVTVADKEAFLAAVAKASTMIKEHPVGGTGLRLY
GTNVLVNILNSVGGLPTGNFQDGHFPTADKVGGETLAANQLQRPKGCFSCIISCGRATKV
TNPKYKGEGEGPEYETAWGFGPDCRIDDLDAVIKANYYCNEYGLDTISMGGTVACAMELF
NRGIITLEDTEGLELDFGNADAMVEAVRLTGLGQGFGKKLALGSYRLASLYGHPELSMTV
KKQEMPAYDPRAVQGIGLNYATNNRGGCHVRGYTISPEVLGVPVKVDKDSIDGKAELVAL
FQNLTAALDSTGSCLFTTFGIGAPEFAELMTALTGFAYTGDSFIEAGERVWNLERLWNLK
SGLTAADDTLPPRLLNEPIVTGASKGAVSRLPEMLPLYYGARGWDAQGVPTKEKLSALAL
A
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgcatggctggattggaaaaatccttcgggtcgatctcggcaccggcaagatcacgacc
gaagcgctgaagcccgacctggcgcgcgattacatcggcgcccgcgggctgggcacgaag
tacatgtatgacgaggtcgatcccacggtggatccgctgtcgccggcgaacaagctgatc
ttcgcctccgggccgatgaccggcaccttcgcgccgtcggccgggcgctacgacgtcgtc
accaaggggccgctgaccggcaccatcgccgcctcgaactccggcggggcctgggggccg
gagctgaaatacgccggctacgacatgctgatcctggaaggccgcgcggccaagccggtc
tatctgtggatccaggacgacaaggtggagatccgcgacgccgcacacctgtggggcaag
gacgtgccggagaccaccgaggcgctgaacgaggagacggcggccgacgccaagatcgcc
tgcatcggaccggcgggcgaaaagctgtcctacatcgcctcgatcatgaacgacatgcag
cgcgccgccggccgcaccggcgtcggcgcggtgatgggatcgaagaacctgaaggcggtg
gtggtgcgcggcaccggcgccgtgaccgtcgccgacaaggaggccttcctggccgcggtc
gccaaggccagcaccatgatcaaggagcatccggtcggcggcaccggcttgcggctctac
ggcaccaacgtgctggtcaacatcctgaattcggtgggcgggctgccgaccggcaacttc
caggacggccatttcccgaccgccgacaaggtgggcggcgaaacgctggcggccaaccag
ctgcagcggccgaagggctgcttctcctgcatcatctcctgcggccgcgccaccaaggtc
accaaccccaaatacaagggcgagggcgaggggccggagtacgagaccgcctggggcttc
ggtccggactgccggatcgacgatctggatgcggtgatcaaggccaactattattgcaac
gaatacggcctcgacaccatctccatgggcggaacggtcgcctgtgcgatggaactgttc
aaccgcggtatcatcacgctcgaagacaccgaagggctggaactggacttcggcaacgcc
gacgcgatggtggaggcggtgcggctgaccggtctcggccagggcttcggcaagaagctg
gcgctgggctcctaccggctggcgagcctctacggccatccggaactgtcgatgaccgtc
aagaagcaggagatgccggcctatgacccgcgcgcggtgcagggcatcggcctgaactat
gccaccaacaaccgcggcggctgccatgtccgcggctataccatcagcccggaagtgctg
ggcgtgccggtgaaggtcgacaaggacagcatcgacggcaaggccgaactggtggccctg
ttccagaacctgacggcggcgctggattcgaccggctcctgcctgttcaccaccttcggc
atcggtgcgccggaattcgccgagctgatgacggcgctgaccggcttcgcctacaccggc
gacagcttcatcgaagccggcgaacgggtctggaacctggagcggctgtggaacctgaag
tccggtctgaccgccgccgacgacaccctgccgccgcgcctgctcaatgagccgatcgtg
accggcgcatcgaagggggcggtcagccgcctgccggaaatgctgccgctctattacggt
gcccgcggctgggacgcccaaggcgttccgaccaaggagaagctgagcgccctggcgctg
gcctga

DBGET integrated database retrieval system