KEGG   Azospirillum lipoferum 4B: AZOLI_p20701Help
Entry
AZOLI_p20701      CDS       T01658                                 

Gene name
xylA
Definition
D-xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ali  Azospirillum lipoferum 4B
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ali00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ali00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p2:complement(701169..702491)
Genome map
AA seq 440 aa AA seqDB search
MSTASFFGDLSPVAYRGPDSRDPLSYRWYDKDRVVLGKRMEDHLRLAACYWHSFCWPGGD
PFGGETFQRPWMRPGQDPMAAARAKADVAFEMFRLLDIPFFCFHDLDAAPEGATLVESVD
NLKAVTELFAAKMETAKVRLLWGTANLFSHRRYMAGAATNPDPDVFLYACGQVRAALEAT
HALGGANYVMWGGREGYETLLNTDLKRELDQMGRFLAMVVEHKHKIGFDGPILIEPKPRE
PTKHQYDFDVATVYGFLERYDLLADVRVNIEQNHAILAGHSFQHEVALALALGIFGSLDM
NRGDALLGWDTDQFANDIGELTVVMHDILKGGGFTTGGLNFDAKIRRQSLDPEDLLHGHI
GGIDSCARALLQAAQMLEDGALTKPLAERYAGWDSAEGQAILSGGRTLATLADRALTGNL
NPQPRSGRQEYLENIVNRYV
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgagcaccgcctcattcttcggcgacctgtccccggtggcctatcgcggaccggacagc
cgcgacccgctgtcctaccgctggtacgacaaggaccgcgtcgtgctgggcaagcggatg
gaggaccatctgcggctggccgcctgctattggcacagcttctgctggccgggcggcgac
cccttcggcggcgagaccttccagcgtccctggatgcgtcccggccaggacccgatggcg
gcggcccgcgccaaggccgatgtcgccttcgagatgttccgcctgctcgacatccccttc
ttctgcttccacgacctcgacgccgcgccggaaggcgccacgctggtcgaaagcgtcgac
aacctgaaggccgtcaccgagctgttcgcggccaagatggagaccgccaaggtccgtctg
ctgtggggcaccgccaatttgttctcccaccgccgctacatggccggcgccgcgaccaac
ccggaccccgacgtcttcctctatgcctgcgggcaggtgcgcgcggcgctggaggccacc
catgcgttgggcggcgccaactacgtcatgtggggcggccgcgagggctatgagacgctg
ctgaacaccgacctgaagcgggagctggaccagatgggccgcttcctggcgatggtggtg
gagcacaagcataagatcggcttcgacggcccgatcctgatcgaaccgaagccgcgcgag
ccgaccaagcaccagtacgacttcgacgtcgccaccgtctacggcttcctggagcgttac
gacctgctggccgacgtgcgggtgaacatcgagcagaaccacgccatcctcgccggccac
agcttccagcacgaggtggcgcttgcgctggcgctcggcatcttcggctcgctcgacatg
aaccgcggcgacgcgctgctgggctgggacaccgaccaattcgccaacgacatcggcgag
ttgacggtcgtcatgcacgacatcctgaagggcggcggcttcaccaccggcggcctgaat
ttcgacgccaagatccgccgccagtcgctcgacccggaggatctgctgcacggccacatc
ggcggcatcgatagttgcgcccgcgccctgctgcaggccgcgcagatgctggaggacggc
gccctgaccaagccgctggccgaacgctacgccggctgggacagcgcggaggggcaggcg
atcctgtccggcggccgcaccctcgccacgctggccgaccgcgcgctgaccggcaacctc
aacccccagccgcgctccggccggcaggagtatctggagaacatcgtcaaccggtacgtc
tga

DBGET integrated database retrieval system