KEGG   Azospirillum lipoferum 4B: AZOLI_p20731Help
Entry
AZOLI_p20731      CDS       T01658                                 

Gene name
nosZ
Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
ali  Azospirillum lipoferum 4B
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:ali00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p2:complement(731733..733682)
Genome map
AA seq 649 aa AA seqDB search
MSSETNNTAGVNRRALLGGTAKAAALAGLTGAVGGAAAGGIAGNALFGASAALAATPQAG
HQSVEVKPGDLDEYYVFHSGGHSGEVRIMGLPSMRELMRIPVFNRCSATGWGLTNESRKI
LTSNLTEETKAFLAKRGGEYLNGDLHHPHMSFTDGTYDGRYIFANDKANSRVTRIRCDIM
KPDVIVEIPNASAIHGLRLQKYPRTGYVFCNGEQRVPTPNDGKILDEPKKYRSHFTAIDG
DTMKIAWQVWVDGNLDNTDADYQGKYVFSTCYNSEEGVTTAEMTANEQDWLVVFNIKRIE
EAVKAGKVEVIHGVPVVDGRHGSAYTRYIPIPNSPHGVNTAPDGIHVTVNGKLSPTVSVM
DVRKLDELFEDKIKPRDVIVAEPQVGLGPLHTAYDGRGNAYTTLFLDSQVVKWNIDKAKR
AFKGEKVDPIIQKLDVHYQPGHLHTSMGQTKEADGKWLIVLNKFSKDRFLNVGPMKPEND
QLIDISGDEMKLVHDGPTFAEPHDTLIVHRSKVNPKSIYTRDDKMWEDARIQAKKDGVDL
DNDTKVIRDGNKVRVYMWSRAPAFGIEEFTVKQGDEVTVYISNMDDVDDLTHGFTMTNHG
VCMEISPQQTASVTFTADRPGVHWYYCQWFCHALHMEMGGRMLVEPRST
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcgagacgaacaacacggcaggcgtcaaccgccgtgcccttctgggcggaacg
gcgaaggcggcggcgctcgccggcctgaccggtgccgtgggcggtgccgccgccggcggc
attgccgggaatgcgctgttcggcgcctcggctgccctggcggcgaccccgcaggccggc
caccagagcgttgaggtgaagcccggcgatctcgacgaatattacgtcttccattccggc
ggccattccggcgaggtccgcatcatgggcctgccgtcgatgcgcgaactgatgcgcatc
ccggtgttcaaccgctgctccgccaccggctggggcctgaccaacgagagccgcaagatc
ctcacctccaacctgacggaggagaccaaggccttcctcgccaagcgcggcggcgagtac
ctgaacggcgacctgcaccacccgcacatgtccttcaccgacgggacctatgacgggcgc
tacatcttcgccaacgacaaggccaacagccgggtgacgcgcatccgctgcgacatcatg
aagccggacgtcatcgtcgagatcccgaacgcctcggccatccacggcctgcgcctgcag
aaatacccgcgcaccggctatgtcttctgcaacggcgagcagcgcgtgccgacgcccaac
gacggcaagatcctggacgagccgaagaagtaccgctcgcacttcaccgccatcgacggc
gacacgatgaagatcgcctggcaggtgtgggtcgacggcaacctcgacaacaccgacgcc
gactatcagggcaaatacgtcttctcgacctgctacaactccgaggaaggggtgacgacg
gccgagatgacggccaacgagcaggattggctggtcgtcttcaacatcaagcgcatcgaa
gaggcggtgaaggccggcaaggtcgaggtgatccacggcgtgccggtggtggacggccgc
cacggcagcgcctacacccgctacatcccgatccccaacagcccgcacggcgtcaacacc
gcccccgacggcatccacgtcaccgtgaacggcaagctgtcgccgaccgtctcggtcatg
gacgtgcgcaagctggacgagctgttcgaggacaagatcaagccgcgcgacgtgatcgtc
gccgaaccgcaggtcggcctcggcccgctccacaccgcctatgacgggcgcggcaacgcc
tacaccaccctgttcctcgacagccaggtggtgaagtggaacatcgacaaggccaagcgc
gccttcaagggcgagaaggtcgatcccatcatccagaagctggacgtgcattaccagccg
ggccacctgcacacctccatgggccagaccaaggaggccgacggcaaatggctgatcgtg
ctgaacaagttctccaaagaccgtttcctcaacgtcggtccgatgaagccggagaacgac
cagctgatcgacatctccggcgacgagatgaagctggttcatgacggccccaccttcgcc
gagccgcacgacacgctgatcgtccaccgctccaaggtcaacccgaagagcatctacacc
cgcgacgacaagatgtgggaagacgcccgcatccaggccaagaaggacggggtggacctg
gacaacgacaccaaggtgatccgcgacggcaacaaggtccgcgtctacatgtggagccgc
gccccggccttcggcatcgaggagttcacggtgaaacagggtgacgaggtgacggtctac
atctccaacatggacgatgtggacgacctgacccacggcttcaccatgaccaaccacggc
gtctgcatggagatcagcccgcagcagaccgcatcggtgaccttcaccgccgaccgtccg
ggcgtgcactggtactactgccagtggttctgccacgccctgcacatggagatgggcggc
cgcatgctggtcgaaccgcgttcgacctga

DBGET integrated database retrieval system