KEGG   Azospirillum lipoferum: AZOLI_p30247Help
Entry
AZOLI_p30247      CDS       T01658                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
ali  Azospirillum lipoferum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZOLI_p30247 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZOLI_p30247 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    AZOLI_p30247 (glcB)
Enzymes [BR:ali01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AZOLI_p30247 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p3:complement(246860..249019)
Genome map
AA seq 719 aa AA seqDB search
MSNWIRRGGLEIARPLYDFINDEALPGTGVDADRLWTGLDQLLHELAPRNKALLAKRDSL
QAQIDAWHAARRGKIFDQAEYESFLREIGYLVPEGGDFTVGTGNVDPEIAYLAGPQLVVP
ITNARYALNAANARWGSLYDALYGTDAIPGTPAAGGYDAARGAQVIAWARKFLDDSVPLA
EGSHADATAYTVEGDALAVTLKSGGKTGLKDKAAFVGWQGEASAPSAVLLVQNGTHIEIR
IDRNSVIGKDDPAGVADVVLEAALSTIQDCEDSVAAVDAEDKVVAYRNWLGLMKGTLEAS
FPKGDKTVVRKLNPDRTYTTPTGSVTLHGRSLLLVRNVGHLMTIDMVKLSDGSEAPEGIL
DGVFTSLIALHDLKASGGLRNSRAGSVYIVKPKMHGPEEVAFTDELFGRVEDLLGMARNT
LKVGIMDEERRTTVNLKECIRAAKDRVVFINTGFLDRTGDEIHTSMEAGPVVRKAAMKAT
KWISAYEDNNVDVGLKAGLKGRAQIGKGMWAMPDLMADMLVAKIGHPKAGANTAWVPSPT
AATLHATHYHAVNVAEVQDQLAKRQAASLSDILTIPLADRPNWSEDEIRQELENNAQGIL
GYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLHHGICTEAQVMEVMKRMA
AVVDKQNAGDPLYKPMAGNVDGSIAFQAACDLVFKGRVQPNGYTEPVLHARRRQAKAAG
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgagcaactggatccgccgcggcggcctcgaaatcgcccgaccgctgtacgacttcatc
aatgacgaggcgctgccggggaccggtgtcgacgccgaccgtctctggacgggcctcgac
cagctcctgcacgagctggcgccgcgcaacaaggccctgttggccaagcgcgacagcctg
caggctcagatcgatgcgtggcatgccgcacgccgcggcaagatcttcgatcaggccgaa
tacgagtccttcctgcgcgagatcggctatctggtgccggagggtggcgacttcaccgtc
ggcaccggcaacgtcgatccggagatcgcctatctcgccggcccgcagctggtggtgccg
atcaccaacgcccgctatgccctgaacgccgccaatgcgcgctggggcagcctgtacgat
gcgctgtacggcaccgacgccatccccggcaccccggcggccggcggctatgatgccgcc
cgcggcgcgcaggtgatcgcctgggcgcgcaagttcctggacgacagcgttccgctggcc
gagggcagccatgccgacgccacggcctacacggtcgagggcgacgcgctggcggtgacg
ctgaagagcggcggcaagaccgggctgaaggacaaggccgccttcgtcggctggcagggc
gaggcttcggccccgtcggccgtgctgctggtccagaacggcacccacatcgaaatccgc
atcgaccgcaacagcgtgatcggcaaggacgacccggccggtgtcgccgacgtcgtgctg
gaagccgccctgtcgaccatccaggactgcgaggattcggttgccgccgtggatgcggag
gacaaggtcgtcgcctaccgcaactggctgggcctgatgaagggcacgctggaggccagc
ttccccaagggcgacaagaccgtcgtccgcaagctgaacccggatcgcacctacaccacg
ccgaccgggagcgtcaccctgcatggccgcagcctgctgctggtccgcaatgtcggccac
ctgatgacgatcgacatggtcaagctgtccgacggcagcgaagcgccggaaggcatcctg
gacggcgtcttcacctcgctgatcgcgctgcacgatttgaaggccagcggtgggctgcgc
aacagccgcgccggctcggtctacatcgtgaagccgaagatgcacgggccggaagaggtc
gccttcaccgacgagctgttcggccgcgtcgaggatctgctgggcatggcccgcaacacc
ctcaaggtcggcatcatggacgaggagcgccgcaccaccgtcaacctcaaggagtgcatc
cgcgccgccaaggaccgcgttgtgttcatcaacaccggcttcctggaccgcaccggcgac
gagatccacacctcgatggaggccggcccggtcgtccgcaaggcggcgatgaaggccacc
aagtggatctcggcctatgaggacaacaacgtcgatgtcggtctgaaggcggggctgaaa
ggccgcgcgcagatcggcaagggtatgtgggcgatgccggacctgatggccgacatgctg
gtcgccaagatcggccacccgaaggccggcgccaacaccgcctgggtcccgtcgccgact
gccgccaccctgcacgccacccactatcacgccgtgaatgtggccgaggtgcaggaccaa
ctggccaagcgccaggcagcatccctgtccgacatcctgaccatcccgctcgccgaccgc
cccaactggtcggaggacgagatccggcaggagctggagaacaacgcccagggcattctc
ggctatgtggtgcgctggatcgaccagggcgtcggctgctccaaggtgccggacatccac
gacgtcgggctgatggaagaccgcgccacgctgcgcatctccagccagcacatcgccaac
tggctgcaccacggcatctgcaccgaggcccaggtgatggaggtcatgaagcgcatggcc
gccgtcgtcgacaagcagaatgccggcgacccgctctacaagccgatggccggcaacgtc
gacggcagcatcgccttccaggcggcctgcgatctggtgttcaagggccgcgtccagccg
aacggctacacggagccggtcctgcatgcgcgccgccgtcaggcgaaggcggcggggtga

DBGET integrated database retrieval system