KEGG   Azospirillum lipoferum: AZOLI_p30287Help
Entry
AZOLI_p30287      CDS       T01658                                 

Definition
putative Arginase/agmatinase/formimionoglutamate hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ali  Azospirillum lipoferum
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AZOLI_p30287
Enzymes [BR:ali01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     AZOLI_p30287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p3:284200..285165
Genome map
AA seq 321 aa AA seqDB search
MAAGMNTRVVEDSTVRWIGGAWENPENNLEGNRPATDPGTELLFLEIPFDHAVSHRPGTR
FGPAAILRALDGFSLYCTDKRVDLAPLRLRRFGEVDVSNDIHATYRHIADTVAGLPSDDT
PVFLGGDHSITDPILRGLLRRHPDRKLGLIVFDAHFDSRVPVPGKEHSGHWMHTVAEVFD
HRHSVQLGVDAPIYSHTYMERAEAAGIMVRTPWDIRRAGLAGTVEEAIRHAVEPTDEVHI
SIDIDCLSAGFAPGTSVPNAAGLMLWDVADAVFEIARSADHASLDIVEVSPPLDAGGITA
QSAAHLVMNFLAGRAARLRQG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggcggccggcatgaacacgcgagtcgtcgaggattccaccgtccgctggattggcgga
gcgtgggaaaatccggaaaacaacctggaaggcaatcggcccgcgaccgaccccggcacc
gaactcctgttcctggagatcccgttcgaccatgcggtcagccaccggccgggcacgcgg
ttcggcccggctgcgatcctgcgggcactggacggtttcagcctctactgcacggacaag
cgggtcgacctggctccgttgcggcttcgccgcttcggggaggtcgatgtctccaacgac
atccacgcgacctaccggcacatcgcggataccgtggccggcctgccttccgacgacacc
ccggtcttcctgggcggcgaccattccatcaccgatccgatcctgcgtggcctgctgcga
cgccatccggaccgcaagcttgggctgatcgtcttcgacgcccatttcgattcgcgcgtt
ccggtgccggggaaggagcattccggacattggatgcatacggtggccgaggtgttcgac
catcgccacagcgtccagctcggggtcgatgcgccgatctactcccacacttacatggag
cgggcggaggcggccgggatcatggtccgcaccccctgggacatccgccgcgccgggttg
gccgggaccgtcgaggaggcgatccgccacgcggtggaaccgaccgacgaagtccatatc
tccatcgacatcgactgcctgtcggcgggcttcgcaccgggaaccagcgttccgaacgct
gccgggttgatgctgtgggacgtcgcagatgcggtgttcgagatcgcgcgcagcgccgac
catgccagcctggacatcgtcgaggtcagccctccgctggacgccggcgggatcaccgcc
caatccgcagcccatcttgtgatgaatttcctggccggaagggcggcccgcctccggcaa
ggctga

DBGET integrated database retrieval system