KEGG   Azospirillum lipoferum: AZOLI_p30425Help
Entry
AZOLI_p30425      CDS       T01658                                 

Gene name
celY
Definition
(GenBank) Endo-1,4-beta-D-glucanase Y (Cellulase Y)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
ali  Azospirillum lipoferum
Brite
Enzymes [BR:ali01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     AZOLI_p30425 (celY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
AZO_p3:complement(452976..454061)
Genome map
AA seq 361 aa AA seqDB search
MASRRDVLFGAATLGLTAGLAAGLSTAFPAAALAAPFDAAAWRRYAERFLQPDGRIVDTG
NKGVSHSEGQGYGMLLAAAAGDRAAFDRMWGWTQRTLMVRGDGLVAWRWTPGGGVTDRNN
ASDGDMLIAWALLRAAELWKTEAYRTAAAAIVKALESGLLVEHAGLTVLLPGRDGFRKGD
TLVLNPSYWIFPAIRAFAALPGGQRWNKVTDSGLVLLSKARFGGFQLPPDWMALDAAGTV
TVAEGFRKQYGYDAVRVPLYLAWDGYRDPYYFRPYADLVAKFGGSTVPATVSLPGGTTTQ
VAASVGMLAVYRLACRLAGAGAGAGGGDMVTVPPLAPDEDYYSTTLFHLSALAAQSLGID
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtggcatcgcggcgtgacgtgctgttcggagcggcaaccctgggcctgacggcgggtctg
gcggccggcctgtcgacggccttcccggccgccgccttagccgcgcccttcgatgcggcg
gcgtggcggcgctatgccgaacgcttcctgcagccggacgggcggatcgtcgacaccggc
aacaagggcgtcagccattccgaagggcagggctacggcatgctgctggccgcggcggcc
ggcgaccgcgccgccttcgaccggatgtggggctggacccagcgcacgctgatggtgcgc
ggcgacgggctggtggcgtggcgctggacccccggcggcggcgtcaccgaccgcaacaac
gcatccgacggcgacatgctgatcgcctgggcgctgctgcgcgccgccgagctatggaag
acggaggcctaccgcaccgccgccgccgccatcgtcaaggcgctggagtccgggcttctg
gtggagcatgccgggctgaccgtcctgctgccggggcgtgacggcttccgcaagggcgac
acgctggtcctcaaccccagctattggatcttcccggccatccgcgccttcgccgccttg
cccggcggacagcgctggaacaaggtgaccgattccggtctggtcctgctgtcgaaggcg
cgcttcggcgggttccagctgccgccggactggatggcgctggacgccgccggcaccgtc
accgtcgccgaaggcttcaggaagcaatatggctacgatgccgtgcgcgtcccgctctat
ctggcctgggacggctaccgcgatccctattatttccggccctatgccgatctggtggcg
aaattcggcggatcgacggtccccgccaccgtctcgctgccgggcggcaccaccacgcag
gtggcggcctccgtcggcatgctggcggtctaccggctggcctgccgccttgccggcgcc
ggagccggggcggggggcggcgacatggtgaccgtgccgccgctggcgccggacgaggat
tactactccaccaccctgttccacctctccgcgctggcggcccaaagcctggggatcgac
ccgtga

DBGET integrated database retrieval system