KEGG   Azospirillum lipoferum: AZOLI_p40099Help
Entry
AZOLI_p40099      CDS       T01658                                 

Definition
endoglucanase (Cellulase, modular protein)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ali  Azospirillum lipoferum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AZOLI_p40099
Enzymes [BR:ali01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     AZOLI_p40099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p4:complement(98498..100864)
Genome map
AA seq 788 aa AA seqDB search
MSTTTAPSKIVVNAYGQSADGVAPNFKLLVDGQEVGTANAATASSKAYSFTANLAANMAH
KIQVVYDNDTATGANRDLYVQSIEVNGHTLQPTDAIYERHDDAAPAPTQAGQEAMWWDGA
LTFSTPASYYAGAQTAAPAAPAAPITAPAAGTAQNVIAVTAAGNAAGGEGAHFTVLVDGK
EIGKGIADSAEAKEFKFTADLAQGAAHSVEVKYDNDAMVDGADRNLYVHSVSVDGKAVAA
TDDAVSVLREADGADLGATTDLYWNATLTAKLDASHFNASTGDAGGDTGSSDGGSAGGPT
GGSTGSGSTPSVKVGNVTVADPGMVQSQSSGSINGFLSTRGNQIVDESGNTVRLTGVNWF
GGEGYNYVPAGLWADSYQGHIDSMKGLGFNVIRLTWADDMFDSEAVTNGIDYSKNPDLKG
LTRLEVYDKVIDYAGKVGMKVILDHHRNDGGAGTNEHGLWYTDNNPESKVIENWKMLAKH
YAGNEAVIGADLHNEPSVSATWGGNAATDWASAAERIGNAIQSVNKDWLMLVEGTEWSST
LAGVKDRPIEFDVPNKLVYSPHAYGHSVGNFSWLNDPAYPNNLPAQYDSMWGYIYKNNIA
PVLIGEFGGQMNSAAEQTWANAFVKYMNGDWDLDGKSDLPAGQQGMNWTYWAWTPESGDV
GGLLKDDYKTIDPNKMNIIKAGLASGTGSSGTVAGSDEAVFTVQLAKAVTTATTIDYATE
DGTAKAGSDYTAASGSLTFQPGETTKTVTVHINGDNSGNEGTENFLLNLTHGNTSIGAAT
GYITEHAA
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgaccaccgcgccgagcaagatcgtcgtcaacgcctacggccagtccgcggac
ggcgtcgcgccgaatttcaagctgctggtggatggtcaggaggtcgggacggccaatgcg
gcgaccgcctcgtcgaaggcctacagcttcaccgccaaccttgcggccaacatggcgcac
aagatccaggtcgtttacgacaacgacaccgcgaccggcgccaaccgcgacctctacgtc
cagtctatcgaggtgaacggccacacgctgcagccgaccgacgccatctatgaacgccat
gacgatgccgccccggcgccgacccaggccggccaggaggccatgtggtgggacggcgcg
ctgaccttcagcacccccgccagctattacgccggtgcccagaccgccgccccggccgcc
cccgcggctccgatcaccgccccggccgccggcaccgcgcagaacgtcatcgccgtgact
gccgccggcaacgccgccggcggcgagggcgcccatttcaccgtgctggtggacggcaag
gagatcggcaagggcatcgccgacagcgccgaagccaaggaattcaagttcaccgccgat
ctggcccagggcgcggcccattcggtcgaggtgaaatacgacaacgacgccatggtcgac
ggtgccgaccgcaacctgtacgtccacagcgtcagcgtcgacggcaaggccgtcgcggcg
accgacgatgcggtgtcggtcctgcgcgaggccgacggtgccgatctgggcgccaccacc
gacctctattggaacgccacgctgaccgcgaagctggatgccagccacttcaacgcctcc
accggcgacgccggcggcgataccggcagcagcgacggcggcagcgcaggcggccccacg
gggggctccaccggcagcggcagcacgccgtcggtcaaggtcggcaacgtcaccgtcgcc
gatccgggcatggtgcagagccagagcagcgggtcgatcaacggcttcctgagcaccagg
ggcaaccagatcgtcgacgaaagcggcaacaccgtccggctgaccggcgtcaactggttc
ggcggcgagggctacaactatgtgccggccggcctgtgggccgacagctatcagggccac
atcgacagcatgaagggcctgggcttcaacgtcatccgcctgacctgggccgacgacatg
ttcgacagcgaggcggtcaccaacggcatcgactattcgaagaacccggacctgaagggc
ctgacccggctggaggtctatgacaaggtcatcgattatgccggcaaggtcggcatgaag
gtgatcctcgaccaccaccgcaacgacggcggcgccggcaccaacgaacacgggctgtgg
tacaccgacaacaacccggaatcgaaggtcatcgaaaactggaagatgctggccaagcat
tatgccggcaacgaggcggtgatcggcgccgacctgcacaacgagccgagcgtgtccgcc
acctggggcggcaacgccgccaccgactgggcctcggccgccgagcgcatcggcaacgcc
atccagtccgtcaacaaggactggctgatgctggtcgaaggcacggagtggagcagcacg
ctggccggcgtgaaggatcgtcccatcgagttcgacgtgccgaacaagctggtctattcc
ccgcacgcctacggccacagcgtcggcaacttcagctggctgaacgacccggcctatccg
aacaacctgccggcccagtacgacagcatgtggggctatatctataagaacaacatcgcg
ccggtgctgatcggcgagttcggcggccagatgaacagcgccgccgagcagacctgggcc
aacgccttcgtcaagtacatgaacggcgactgggatctggacggcaagagcgacctgccg
gccggccagcagggcatgaactggacctattgggcctggacgccggaatcgggcgatgtc
ggcggcctgctgaaggacgactacaagaccatcgacccgaacaagatgaacatcatcaag
gcgggtctggcgtccggcaccggcagctccggcaccgtggcgggcagcgacgaggcggtc
ttcaccgtgcagctggccaaggcggtcaccaccgccaccaccatcgactatgcgaccgag
gacggcaccgccaaggccgggtccgactacaccgccgccagcggcagcctgaccttccag
ccgggcgagaccaccaagaccgtcaccgtccacatcaacggcgacaattcgggcaatgaa
ggaacggagaacttcctgctgaacctgacccacggcaacaccagcatcggtgccgccacg
ggttacatcaccgagcacgcggcgtaa

DBGET integrated database retrieval system