KEGG   Azospirillum lipoferum: AZOLI_p40163Help
Entry
AZOLI_p40163      CDS       T01658                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ali  Azospirillum lipoferum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AZOLI_p40163 (galU)
   00052 Galactose metabolism
    AZOLI_p40163 (galU)
   00500 Starch and sucrose metabolism
    AZOLI_p40163 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    AZOLI_p40163 (galU)
Enzymes [BR:ali01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AZOLI_p40163 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p4:154106..154975
Genome map
AA seq 289 aa AA seqDB search
MRKPVRKVVFPVAGLGTRFLPATKAIPKEMLPLVDRPLLQHAVEEARAAGIEDFVFVTGR
SKRAIEDHFDADTELNRTLEERGKQDALEEVRHSEIAPGRCFYTRQQVPLGLGHAVWCAR
ALIGNDPFAIVLPDDYVQGKTPCLKQMVEAYEEVGGNIVAVVDVPRERTSSYGILDVEKD
DGRLATVRGLVEKPKPEEAPSTLSIIGRYILQPEIFDHLEKQQRGAGNEIQLTDAMAKLI
GNQPFHGLRFEGTRYDCGDKVGFIEATLAHALNRPDMADKVREMLRKYC
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaacccgtgcgcaaggtggtgttcccggtcgccggtctcggcacgcgcttcctg
ccggccaccaaggccatcccgaaagagatgctgcccctggtcgaccgccccctgctgcag
cacgccgtcgaagaggcgcgcgccgccggcatcgaggatttcgttttcgtcaccggccgt
tccaagcgcgccatcgaagaccatttcgacgccgataccgaactgaaccgcacgcttgaa
gagcgcggcaagcaggacgcactggaggaggtccgccacagcgagatcgcccccggccgc
tgcttctacacccgccagcaggttccgctcggcctcggccacgccgtgtggtgcgcccgc
gccctgatcggcaacgacccgttcgccatcgtgctgcccgacgattacgtccagggcaag
accccctgcctgaagcagatggtcgaggcctatgaggaggtcggcggcaacatcgtcgcg
gtggtcgacgtgccgcgcgaacgcaccagcagctacggcatcctggacgtcgagaaggac
gacggccgtctggccaccgtccgcggcctggtggagaagcccaagccggaagaggcgccg
tcgaccctgtcgatcatcggccgctacatcctgcagccggaaatcttcgatcatctggaa
aagcagcagcgcggcgccggcaacgagatccagctgaccgacgccatggccaagctgatc
ggcaaccagcccttccacggcctgcgcttcgaaggcacccgctacgactgcggcgacaag
gtcggcttcatcgaggcgacgctcgcccacgcgctgaaccggccggacatggccgacaag
gtgcgcgagatgctgcgcaaatattgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system