KEGG   Azospirillum lipoferum: AZOLI_p40163Help
Entry
AZOLI_p40163      CDS       T01658                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ali  Azospirillum lipoferum
Pathway
ali00040  Pentose and glucuronate interconversions
ali00052  Galactose metabolism
ali00500  Starch and sucrose metabolism
ali00520  Amino sugar and nucleotide sugar metabolism
ali01100  Metabolic pathways
ali01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AZOLI_p40163 (galU)
   00052 Galactose metabolism
    AZOLI_p40163 (galU)
   00500 Starch and sucrose metabolism
    AZOLI_p40163 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    AZOLI_p40163 (galU)
Enzymes [BR:ali01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AZOLI_p40163 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: CBS90561
UniProt: G7ZGW1
Position
AZO_p4:154106..154975
Genome map
AA seq 289 aa AA seqDB search
MRKPVRKVVFPVAGLGTRFLPATKAIPKEMLPLVDRPLLQHAVEEARAAGIEDFVFVTGR
SKRAIEDHFDADTELNRTLEERGKQDALEEVRHSEIAPGRCFYTRQQVPLGLGHAVWCAR
ALIGNDPFAIVLPDDYVQGKTPCLKQMVEAYEEVGGNIVAVVDVPRERTSSYGILDVEKD
DGRLATVRGLVEKPKPEEAPSTLSIIGRYILQPEIFDHLEKQQRGAGNEIQLTDAMAKLI
GNQPFHGLRFEGTRYDCGDKVGFIEATLAHALNRPDMADKVREMLRKYC
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaacccgtgcgcaaggtggtgttcccggtcgccggtctcggcacgcgcttcctg
ccggccaccaaggccatcccgaaagagatgctgcccctggtcgaccgccccctgctgcag
cacgccgtcgaagaggcgcgcgccgccggcatcgaggatttcgttttcgtcaccggccgt
tccaagcgcgccatcgaagaccatttcgacgccgataccgaactgaaccgcacgcttgaa
gagcgcggcaagcaggacgcactggaggaggtccgccacagcgagatcgcccccggccgc
tgcttctacacccgccagcaggttccgctcggcctcggccacgccgtgtggtgcgcccgc
gccctgatcggcaacgacccgttcgccatcgtgctgcccgacgattacgtccagggcaag
accccctgcctgaagcagatggtcgaggcctatgaggaggtcggcggcaacatcgtcgcg
gtggtcgacgtgccgcgcgaacgcaccagcagctacggcatcctggacgtcgagaaggac
gacggccgtctggccaccgtccgcggcctggtggagaagcccaagccggaagaggcgccg
tcgaccctgtcgatcatcggccgctacatcctgcagccggaaatcttcgatcatctggaa
aagcagcagcgcggcgccggcaacgagatccagctgaccgacgccatggccaagctgatc
ggcaaccagcccttccacggcctgcgcttcgaaggcacccgctacgactgcggcgacaag
gtcggcttcatcgaggcgacgctcgcccacgcgctgaaccggccggacatggccgacaag
gtgcgcgagatgctgcgcaaatattgctga

DBGET integrated database retrieval system