KEGG   Azospirillum lipoferum: AZOLI_p40441Help
Entry
AZOLI_p40441      CDS       T01658                                 

Gene name
cheB2
Definition
Chemotaxis glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ali  Azospirillum lipoferum
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ali00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZOLI_p40441 (cheB2)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AZOLI_p40441 (cheB2)
Enzymes [BR:ali01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AZOLI_p40441 (cheB2)
Two-component system [BR:ali02022]
 CheA family
  CheA-CheYBV
   AZOLI_p40441 (cheB2)
Bacterial motility proteins [BR:ali02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AZOLI_p40441 (cheB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p4:complement(426366..427463)
Genome map
AA seq 365 aa AA seqDB search
MVVDDSAVIRGLLTRALEGDPDIRVVTSVGDGQMAVNSLQRNSIDVIVLDIEMPVMDGLT
AIPKLLAVAPQVKIIMASTLTLRGADVSIRCLSAGAADYIPKPTSTREIGGAEDFKRELV
AKVKALGAAARRAGSRSRGEIRPLTPAAPVGLLKREVGPIVTRPAPAGTMAVKPDVIAIG
SSTGGPQALFEVLSHLKAGVSQPILITQHMPATFTTILAEHITRQCGIDAREAKDGEPIV
QNRCYIAPGDFHMLVAQRGGANVITLSKDPPENFCRPAVDPMMRSILKAFGGRKILACIL
TGMGQDGLKGCTDVVNGGGMLIAQDEASSVVWGMPGAVAQAGICSAILPLKEIGPHIRKL
ASRAA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggacgactcggccgtcatccgcggcctgctgacccgcgcgctggaaggagac
cctgacatccgcgtcgtcacctcggtgggcgacggccagatggcggtcaattcgctgcag
cgcaactcgatcgacgtcatcgttctggacatcgagatgccggtgatggacgggctgacc
gccatcccgaagctgctggcggtggcgccgcaggtgaagatcatcatggcctccacgctg
acgctgcgcggggccgacgtgtcgatccgctgcctgtcggcgggtgccgccgactacatc
ccgaagccgacctcaacccgcgagatcggcggggcggaggacttcaagcgcgagctggtc
gccaaggtcaaggcgctgggtgccgcggccaggcgcgccgggtcgcgctcgcgcggtgaa
atccgcccgctgaccccggcggctccggtcgggctgctgaagcgcgaggtcgggccgatc
gtcacccgcccggccccggccggcaccatggcggtgaagccggacgtgattgccatcggc
agctccaccggcggtccgcaggcgctgttcgaggtgctgtcgcacctgaaggccggcgtc
agccagccgatcctgatcacccagcacatgccggcgaccttcaccaccatcctggccgag
catatcacccgccaatgcgggatcgatgcgcgcgaggccaaggacggcgagccgatcgtc
cagaaccgctgctacatcgcgcccggcgacttccacatgctggtggcgcagcgcggcggg
gccaacgtaatcacgctcagcaaggatccgcctgagaatttctgccgcccggccgtcgat
ccgatgatgcggtcgatcctgaaggccttcggcggccgcaagatcctggcctgcatcctg
accggcatggggcaggacgggctgaagggctgcaccgacgtcgtcaacggcggcggcatg
ctgatcgcccaggacgaggcgtcgagcgtggtctggggcatgccgggtgccgtggcgcaa
gccggcatctgcagcgccatcctgccgctcaaggaaatcggtccccacatccgcaagctc
gcttcgagggcagcatga

DBGET integrated database retrieval system