KEGG   Azospirillum lipoferum 4B: AZOLI_p40441Help
Entry
AZOLI_p40441      CDS       T01658                                 

Gene name
cheB2
Definition
Chemotaxis glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ali  Azospirillum lipoferum 4B
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ali02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ali02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p4:complement(426366..427463)
Genome map
AA seq 365 aa AA seqDB search
MVVDDSAVIRGLLTRALEGDPDIRVVTSVGDGQMAVNSLQRNSIDVIVLDIEMPVMDGLT
AIPKLLAVAPQVKIIMASTLTLRGADVSIRCLSAGAADYIPKPTSTREIGGAEDFKRELV
AKVKALGAAARRAGSRSRGEIRPLTPAAPVGLLKREVGPIVTRPAPAGTMAVKPDVIAIG
SSTGGPQALFEVLSHLKAGVSQPILITQHMPATFTTILAEHITRQCGIDAREAKDGEPIV
QNRCYIAPGDFHMLVAQRGGANVITLSKDPPENFCRPAVDPMMRSILKAFGGRKILACIL
TGMGQDGLKGCTDVVNGGGMLIAQDEASSVVWGMPGAVAQAGICSAILPLKEIGPHIRKL
ASRAA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggacgactcggccgtcatccgcggcctgctgacccgcgcgctggaaggagac
cctgacatccgcgtcgtcacctcggtgggcgacggccagatggcggtcaattcgctgcag
cgcaactcgatcgacgtcatcgttctggacatcgagatgccggtgatggacgggctgacc
gccatcccgaagctgctggcggtggcgccgcaggtgaagatcatcatggcctccacgctg
acgctgcgcggggccgacgtgtcgatccgctgcctgtcggcgggtgccgccgactacatc
ccgaagccgacctcaacccgcgagatcggcggggcggaggacttcaagcgcgagctggtc
gccaaggtcaaggcgctgggtgccgcggccaggcgcgccgggtcgcgctcgcgcggtgaa
atccgcccgctgaccccggcggctccggtcgggctgctgaagcgcgaggtcgggccgatc
gtcacccgcccggccccggccggcaccatggcggtgaagccggacgtgattgccatcggc
agctccaccggcggtccgcaggcgctgttcgaggtgctgtcgcacctgaaggccggcgtc
agccagccgatcctgatcacccagcacatgccggcgaccttcaccaccatcctggccgag
catatcacccgccaatgcgggatcgatgcgcgcgaggccaaggacggcgagccgatcgtc
cagaaccgctgctacatcgcgcccggcgacttccacatgctggtggcgcagcgcggcggg
gccaacgtaatcacgctcagcaaggatccgcctgagaatttctgccgcccggccgtcgat
ccgatgatgcggtcgatcctgaaggccttcggcggccgcaagatcctggcctgcatcctg
accggcatggggcaggacgggctgaagggctgcaccgacgtcgtcaacggcggcggcatg
ctgatcgcccaggacgaggcgtcgagcgtggtctggggcatgccgggtgccgtggcgcaa
gccggcatctgcagcgccatcctgccgctcaaggaaatcggtccccacatccgcaagctc
gcttcgagggcagcatga

DBGET integrated database retrieval system