KEGG   Azospirillum lipoferum: AZOLI_p50190Help
Entry
AZOLI_p50190      CDS       T01658                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ali  Azospirillum lipoferum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AZOLI_p50190 (glpK)
Enzymes [BR:ali01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     AZOLI_p50190 (glpK)
Exosome [BR:ali04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZOLI_p50190 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p5:complement(182390..183883)
Genome map
AA seq 497 aa AA seqDB search
MSKAGHILAIDQGTTSSRAILFDGRGRPLAEARREFPQHYPGDGWVEHDPSDILRDVRAV
ARGAVENAGIDVASIAAIGITNQRETAVVWDRATGEPIHRAIVWQDRRTAPLCHDLVADG
HAELVRSKTGLLIDAYFSATKIAWIIDHVPGARARAERGELCFGTIDSFLIYHLTGRRVH
ATDATNASRTMLFDIHAQDWDDELLRLFRVPRAMLPRVLDSSDDFGETDPELLGRPIPIA
GVAGDQQAAAFGQACLTPGMAKSTYGTGCFALINTGETPVVSKNRLLTTVAYRLNGKAAY
AQEGSIFVAGAAIKWLRDGIGIITHASQTDDMATRVPDSHGVYFVPAFVGLGAPHWDSEA
RAAIFGMTLDVGPAHIARAALEAVAYQTRDLMEAMAGDWGGTINALRVDGGMAANDWLCQ
FLADLLNMPVERPKVIETTALGAACLAALRVGVFNGLESVSDAWGSERRFDPRMEQGKRD
RLYDGWRDAVERVRSDR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggccggtcacatcctcgccatcgaccagggcaccacctcgtcgcgggcgatc
ctgttcgacggccgggggaggccgctggccgaggcgcggcgcgagtttccgcagcattac
cccggcgacggctgggtcgagcatgatccgtccgacatcctgcgcgatgtccgcgccgtg
gcgcgcggggcggtggagaatgccggaatcgatgtggcatccatcgccgccatcggcatc
accaaccagcgcgaaaccgccgtggtgtgggaccgcgcgaccggcgagccgatccaccgc
gccatcgtctggcaggaccgccgcaccgcgccgctctgccacgatctggttgccgacggc
catgccgaactggtgcgttccaagaccggcctgctgatcgacgcctatttctccgccacc
aagatcgcctggattatcgaccatgtgccgggcgcccgcgcgcgggccgagcggggcgag
ctgtgcttcggcaccatcgacagtttcctgatctaccacctgaccggccgccgggtgcat
gcgaccgacgcgaccaacgcctcgcgcaccatgctgttcgacatccatgcccaggattgg
gacgacgagctgctgaggctgttccgtgtgccgcgcgccatgctgccgcgggtgctcgac
agctccgacgatttcggtgagaccgatccggagctgctcggccggccgatccccatcgcc
ggcgtggcgggcgaccagcaggcggcggctttcggacaagcctgcctgacgccgggcatg
gcgaaatcgacctacggcaccggttgcttcgcgctgatcaacaccggcgagacgccggtg
gtgtcgaagaaccggctgctgaccacggtcgcctaccgtctgaacggcaaggcggcctat
gcgcaggaaggctcgatcttcgtggcgggagccgcgatcaagtggctgcgcgacggcatc
ggcatcatcacccacgccagccagaccgacgacatggccacccgcgtgcccgacagccac
ggcgtctatttcgtcccggccttcgtgggcttgggcgcgccgcactgggattcggaggcc
cgcgccgcgatcttcggcatgacgctggacgtcggcccggcccacatcgcccgcgcggcg
ctggaggccgtcgcctaccagacccgcgacctgatggaggcgatggcgggcgattggggc
ggcaccatcaatgcgctgcgcgtcgacggcggcatggccgccaacgactggctctgccaa
ttcctggccgacctgctgaacatgccggtggagcgcccgaaggtgatcgagaccacggcg
ctgggcgccgcctgccttgcggcgctgcgggtcggcgtgttcaacgggctggagtcggtt
tccgacgcctggggcagcgagcgccgcttcgacccgcgcatggaacagggcaagcgcgac
cgcctctatgacggctggcgcgacgccgtggagcgggtgcggtccgatcgctga

DBGET integrated database retrieval system