KEGG   Azospirillum lipoferum: AZOLI_p50218Help
Entry
AZOLI_p50218      CDS       T01658                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; isopentenyl monophosphate kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ali  Azospirillum lipoferum
Pathway
ali00900  Terpenoid backbone biosynthesis
ali01100  Metabolic pathways
ali01110  Biosynthesis of secondary metabolites
ali01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AZOLI_p50218 (ispE)
Enzymes [BR:ali01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     AZOLI_p50218 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CBS91215
UniProt: G7ZHX7
Position
AZO_p5:215110..216150
Genome map
AA seq 346 aa AA seqDB search
MTGIPIVEAAPAKLNLYLHVTGRCADGYHELDSLVAFAELGDVITLTTGAARVALRGADL
PPAGPRLAIAGPFGPVLMGENPADNLVIRAAHALAARLGRQADAMIALTKALPVASGIGG
GSADAAACLRALARLWGVPTDDPALFAVAAGLGADVPVCVAGRSCYFGGIGDVLDEAPEL
PETHVVLVNPNLPVPTPAVFKAMAAARAQGGAPFSAPARFTRKPADAADLTALLLERHND
LTAPALTVAPVIADVLAALERSAGCLLPRLSGSGATCFGLYGTAQQAEAAAKAIAAAEPG
WWVKPTRLRPTPPDAPALPRGIVADPAAAVPPPAVPFPDTGGWGVG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcattcccatcgtcgaggccgccccggccaagctgaacctgtacctgcacgtc
accggccggtgcgccgacggctatcacgagctggacagcctcgtcgccttcgccgagctt
ggcgacgtcatcaccctgaccacgggcgccgcgcgggtggcgctgcgcggtgccgacctg
ccgccggccgggccgcggctggccatcgccggccccttcggcccggtgctgatgggcgag
aacccggccgacaatctggtgatccgcgccgcccatgcgctggccgcccggctgggacgc
caggccgacgcgatgatcgcgctgaccaaggcgctgccggtcgcatccggcatcggcggc
gggtcggccgacgccgccgcctgcctgcgggcgctggcccgcctgtggggggttcccacc
gacgatccggcactgttcgcggtggccgccgggctgggcgccgacgtgccggtctgcgtc
gccgggcgcagctgctatttcggcggcatcggcgacgtgctggacgaggcgccggagttg
ccggaaacccatgtggttctggtcaacccgaacctgccggtgccgacgccggcggtgttc
aaggcgatggccgccgcaagggcgcagggcggcgccccattctccgcccccgcccgcttc
acccgcaagccggcggatgcggccgatctcaccgcgctgctgctggaacggcacaacgac
ctcaccgccccggccctgacggtcgccccggtgatcgccgacgtgctggcggcgctggag
cgcagcgccggctgcctgctgccccgcctgtcgggaagcggcgccacctgcttcggcctc
tatggcacggcgcagcaggcggaggccgcggcgaaggccatcgccgcagcggagccgggc
tggtgggtcaagccgacccgcctgcgccccaccccgcccgacgccccggccctgccacgc
ggcatcgtcgccgatcccgccgccgcagtcccgccgcccgccgttcccttccccgacacc
ggcggctggggagtcggctga

DBGET integrated database retrieval system