KEGG   Azospirillum lipoferum: AZOLI_p50269Help
Entry
AZOLI_p50269      CDS       T01658                                 

Definition
(GenBank) Putative acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ali  Azospirillum lipoferum
Pathway
ali00300  Lysine biosynthesis
ali01100  Metabolic pathways
ali01120  Microbial metabolism in diverse environments
ali01230  Biosynthesis of amino acids
Module
ali_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    AZOLI_p50269
Enzymes [BR:ali01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     AZOLI_p50269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: CBS91266
UniProt: G7ZHF4
Position
AZO_p5:283085..284389
Genome map
AA seq 434 aa AA seqDB search
MRSDTDAATSQLFRRIEVRRDDLVALTQDLIRIPTVNPPGDVYTDCAELIGRRLTARGFS
VEYVRAEGAAGDSDRYPRTNVVARIEAPRPGPCVHFNGHIDVVPAGQGWTVDPFGGVVKD
GRVYGRGACDMKGGIAASIVAVESLLEEGLLTAGALEISGTVDEESGGYGGVGHLAKLGY
FSRPRVDHVIIPEPLNVDRVCIGHRGVWWAEIETKGRVAHGSMPFLGNCAVRHMGAVLHR
IETELIPRLAAKRTDMPVVPEGARQSTININAIHGGQREDHDGLPSPMVPDRCRMVIDRR
YLIEEDPEAVRGEIVAILEDLRRSRPGFDYELREVLAFLPTMTDADAPVVRAVAAAIETV
LGRPAQHVVSPGTYDQKHVVRVGQLKDCIAYGPGILDLAHQPDEWVGIEDMVQSAQVMAL
ATLGLLGGDYGLRF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgcgatccgataccgacgccgcaaccagccagctgttccgccggatcgaggtgcggcgc
gacgatctggtcgcgctgacgcaggacttgatccgcatccccaccgtcaatccgccgggc
gacgtctataccgattgcgccgagctgatcggccgccggctgacggcgcgcggattctcg
gtggagtatgtgcgggcggagggggcggccggcgacagcgaccgctacccgcgcaccaac
gtcgtcgcccgcatcgaggcaccgcggccggggccttgcgtccacttcaacggccatatc
gacgtggtgccggccggccagggctggaccgtagatcccttcggcggggtggtgaaggac
ggccgggtctatggccgcggcgcctgcgacatgaagggcggcatcgccgcctcgatcgtc
gccgtcgaatcgctgctggaggaagggctgctgaccgccggcgccctggagatttccggc
acggtggacgaggaatccggcggttacggcggcgtcggccatctggcgaagctcggctat
ttctcccggccgcgcgtcgaccacgtcatcatcccggagccgctgaacgtcgaccgcgtc
tgcatcggccaccgcggcgtctggtgggcggagatcgagaccaagggccgcgtcgcccat
ggctccatgcccttcctcggcaactgcgcggtgcgccacatgggcgccgtgctgcaccgg
atcgagacggagctgatcccccgcctcgccgccaagcgcaccgacatgccggtggtgccg
gagggcgcgcgccagtccaccatcaacatcaacgccatccatggcggccagcgcgaggac
catgacggcctgccgagcccgatggtgcctgaccgctgccgcatggtgatcgaccgccgt
tacctgatcgaggaggaccccgaggctgtccgcggcgagatcgtcgccatcctggaggat
ctgcgccgcagccgccccggcttcgattacgaactgcgcgaggtgctggccttcctgccg
acgatgaccgatgccgacgcccccgtcgtacgggcggtcgccgccgccatcgagacggtg
ctgggccgcccggcgcagcatgtcgtctcccccggcacctacgaccagaagcatgtggtg
cgcgtcggccagttgaaggactgcatcgcctacggccccggcatcctcgacctcgcccac
cagcccgacgaatgggtcggcatcgaagacatggtgcagtcggcgcaggtgatggcactg
gcaacgctggggttgttgggaggtgattatggattacgattctga

DBGET integrated database retrieval system