KEGG   Azospirillum lipoferum 4B: AZOLI_p50318Help
Entry
AZOLI_p50318      CDS       T01658                                 

Gene name
melA
Definition
Alpha-galactosidase (Melibiase)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
ali  Azospirillum lipoferum 4B
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ali00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ali00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p5:331795..333078
Genome map
AA seq 427 aa AA seqDB search
MPNTTKIVFIGAGSAAFGLSLFQDLFSTTELAGSTLTLVDTNTEALDRMAALAEVMNRHG
DAGITIEKTTDRKAALQGAGFVLCAIAIDRNRLWRLDFEVPKKHGIRHTLGENGGPGGLF
FTLRTLPLIVDIVRDVEAICPDALFINLSNPESRIVLGLSRCTSVRTLGLCHGIFLARWF
ICQILGMAEKEVDVWGAGLNHFQWLTAIREKATGRDLYPLLREREATHDPSFTPLARRLF
HAFGLWVTPSDDHTGEFLPYGWEAGEHGFDFKHDEDGRIILRDLMDGVIDGSKPIPDDWT
KPSWGERAVAVIAGQLHNQKRFIESGIVINRGVIPGLPDELAVEVPLVADAAGIHPISLG
RLPDGIVKLLSVQANVQQLSVEAALHGSKELALQALLIDPVINSSTAAVAILDELWEANR
PYIRACL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacaccaccaagatcgtcttcatcggtgccggcagcgccgccttcgggctcagc
ctgttccaggacctgttctccaccaccgaacttgccggcagcaccctgacgctggtcgac
accaacactgaggcgctcgaccgcatggcggcgctggccgaggtgatgaaccgccacggc
gacgccggcatcaccatcgagaagaccaccgaccgcaaggccgccctgcagggcgccggc
ttcgtgctgtgcgccatcgccatcgaccgcaaccggctgtggcggctggatttcgaggtg
ccgaagaagcacggcatccgccacacgctgggcgagaacggcggccccggcgggctgttc
tttacgttgcgcaccctgccgctgatcgtcgacatcgtccgcgacgtcgaggcgatctgc
cccgacgcgttgttcatcaacctgtccaacccggaaagccgcatcgtcctgggcctgtcg
cgctgcacctccgtgcggacgctggggctctgccacggcatcttcctggcgcgctggttc
atctgccagatcctgggcatggccgagaaggaggtggatgtctggggcgccgggctgaac
catttccaatggctgaccgccattcgcgagaaggcgacgggccgcgatctctaccccctg
ctgcgcgagagggaggcgacgcacgacccgtccttcaccccgctggcgcggcgcctgttc
cacgcctttggcctgtgggtgacgcccagcgacgaccacaccggcgagttcctgccctat
ggctgggaagccggcgagcacggcttcgacttcaagcatgacgaagacggccgaatcatc
ctgcgcgacctgatggacggggtgatcgacggcagcaaaccaatccccgacgactggacc
aagccgtcctggggcgagcgggcggtggcggtgatcgccggccaactgcacaaccagaag
cgcttcatcgagagcggcatcgtcatcaaccgcggcgtcatccccggcctgcccgacgag
ctggcggtggaggtgccgctggtggcagacgccgccggcatccatcccatctcgctcggc
cgcctgcccgacggcatcgtcaagctgctgtcggtccaggccaacgtgcagcaattgtcg
gtggaggcggcattgcacgggtcgaaggagttggcgctgcaggccctgctgatcgacccc
gtcatcaattccagcacggcggccgttgccatcctggacgagctgtgggaggcgaaccgg
ccctatatccgggcttgcctgtga

DBGET integrated database retrieval system