KEGG   Azospirillum lipoferum 4B: AZOLI_p50370Help
Entry
AZOLI_p50370      CDS       T01658                                 

Gene name
galM2
Definition
Aldose 1-epimerase (Galactose mutarotase)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ali  Azospirillum lipoferum 4B
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ali00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ali00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p5:complement(393026..394075)
Genome map
AA seq 349 aa AA seqDB search
MMPIESFLFDTVEGRPVEGFTLSAGGLEATVIAHGARLVRMTVPGQDGTVADVVLGFDRV
ADYLASDAYFGATCGRYGNRIGGAAFTLDGVRHELAVNEPPNQLHGGPEGFDRRIWDATV
EEAENAVTFTLVSPDGDQGYPGTLTATTRYRLTDDGVLDIRMTATTDRPTIVNLVHHSYW
NLGGHASGDLRDHRLTVRGGFTTPVGADLIPTGEVRPVDGTPFDLRGEVGRGGVRLGEAL
DAVGGFGFDHNWCLEGPAGELRPVAVLEHPGSGRRMELATDQPGLQVYTGGYLSEQVVGK
GGQPYRRFAGLALESQRFPGSPNIGHFPSARLDPGETYRHRMQLRFRAG
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcccatcgagagtttcctgttcgatacggtcgagggccgtccggtggagggcttc
accctctccgccggcgggctggaggcgacggtgatcgcccatggcgcccggctggtgcgg
atgacggtgcccggccaggacgggaccgtcgccgacgtggtgctgggcttcgaccgggtg
gccgactatctggcgagcgacgcctatttcggcgcgacttgcggccgctatggcaaccgc
atcggcggagcggccttcacgctggacggcgtgcgccatgaactggccgtcaacgagccg
ccgaaccagctgcatggcgggccggagggcttcgaccggcggatttgggatgcgacggtg
gaggaggcggagaacgccgtcaccttcacgctcgtctcgccggacggtgaccagggctat
cccggaacgctgacggcgacgacacgctaccggttgaccgacgacggcgtgctcgacatc
cgcatgacggcgacgaccgaccggccgaccatcgtcaaccttgtccatcacagctactgg
aacctcgggggacatgcctcgggcgatcttcgcgaccatcggctgacggtgcgcggcggt
ttcaccacgccggtcggcgccgacctgattccgacgggggaggtgcggccggtggacggc
acccccttcgacctgcgcggtgaagtggggcgcggcggggtgcggctgggcgaggctttg
gacgcggtcggcggtttcggtttcgaccacaactggtgcctggaggggccggcgggggaa
ctgcgcccggtggccgtgctggagcatccgggcagcggccggcggatggagctggcgacc
gaccagccgggcctgcaggtctataccggcggctatctcagcgagcaggtggtgggaaag
ggcgggcagccttatcggcgcttcgccgggctggcgctggaaagccagcgttttcccggc
agccccaacatcggccatttcccgtcggcccggctggaccccggcgagacataccggcac
cgcatgcagctgcgattccgggcgggctga

DBGET integrated database retrieval system