KEGG   Alteromonas sp. SN2: ambt_00585Help
Entry
ambt_00585        CDS       T01513                                 

Definition
endoglucanase Y
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
alt  Alteromonas sp. SN2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ambt_00585
Enzymes [BR:alt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     ambt_00585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
142073..143131
Genome map
AA seq 352 aa AA seqDB search
MVDGGRGWRFIRLVGLFGLLGILASCSNPEEREIQEAFQAYKALFIDNGRIIDTGNGDVS
HSEGQGYGLLFAVAANDRTAFDSIWMWTHTVLQRDDKLFHWRYRPCESKNKQCIDDPNNA
SDGDLLIAWALLRAADKWGEKSYRHDAQVIITAIEEKLFIETEAFLVLLPGEFGFKSDES
NDEGIQLNLSYWVFPAIDAITEVSSRALRWKALHRSGTALIYKARFSKHKLPPDWLRVNE
GALSLTNTVSQEYGFNACRIPLHLAWAGIDDAAFYSDFERWWDIENTPATVNLLTNEIAE
YAMTPGMKAVESAVKHIIDGSPLSLPAIDRNMDYYSASLTLLSMVAVMDAKS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggtagacggcggtaggggctggcggttcattcgactcgtcggcctgtttgggctgcta
ggtatattggcgtcatgtagcaaccctgaagagcgtgaaatacaagaagcgtttcaagcc
tataaagccttgtttatcgacaatggtcgtatcatcgatacgggtaatggcgatgtatct
catagtgaggggcaagggtacggtctattgttcgcggttgctgctaacgacagaaccgct
tttgatagtatatggatgtggactcacactgtacttcagcgggacgataagctatttcat
tggcgctaccgcccctgtgaaagtaaaaataagcaatgtatagacgacccaaataacgcc
tcagatggcgacctacttattgcttgggcacttctgcgtgctgctgataagtggggagaa
aaaagctatcggcatgatgctcaagtcatcataacggctatcgaagaaaagttgtttatt
gaaaccgaagcgttcctagtgctattgccaggagagttcggttttaagagtgatgagagt
aatgatgagggcatacaacttaatttgtcttattgggtgtttcccgccattgatgcgatt
actgaggtttcgtctcgggcactacgctggaaagcattacaccgcagtggcactgcgctt
atttacaaagcacgtttttctaaacacaaactgcccccagactggttaagagtgaacgaa
ggagccttgtctttaaccaatactgtgtctcaggaatatggctttaatgcctgtcgtata
ccccttcaccttgcgtgggcaggtatagatgatgccgcattttattctgattttgagcgc
tggtgggacatagaaaatacaccggctaccgtcaatttactcaccaatgaaatagctgaa
tatgcgatgacaccagggatgaaagccgttgagtctgcggtaaaacatattattgatggt
agtccactgtcacttccagcgattgacagaaatatggattattattcggcgagtttaacc
ttgctctctatggttgctgttatggatgccaagtcttaa

DBGET integrated database retrieval system