KEGG   Alteromonas sp. SN2: ambt_00785Help
Entry
ambt_00785        CDS       T01513                                 

Definition
putative delta-9 fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
alt  Alteromonas sp. SN2
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ambt_00785
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ambt_00785
Enzymes [BR:alt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     ambt_00785
Lipid biosynthesis proteins [BR:alt01004]
 Desaturase
  First
   ambt_00785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(184572..185663)
Genome map
AA seq 363 aa AA seqDB search
MFIITGAIAFIGVPVWVINHGIDWAEIGTAIFLFYFTGMSITAGYHRLWSHKTYDANIVV
RVILAIGGAMALQNSILHWSSDHRIHHRHVDDNDKDPYSAKRGLWFAHIGWMLREYQEKR
YDDYRNCKDLQKDKVVMWQHNYYLPIVLAANFGVTGFLGWLNGDILGMILVAGVLRLVLV
HHVTFFINSLAHFWGNQPYTDANTARDNGVLAFFTFGEGYHNYHHIFEYDYRNGIRWYQF
DPTKWLIRGLSYVGLTHNLRRVPEERIEKARAAMQLQRASEQVSVLPNAEELMHTIEQEY
ELLMQRMSDYYAAKKRLMKVKQKSLKRTIEGLELTYKYKELKHALAVQKEKWLQLQSLSL
QAA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgttcataattaccggcgccatcgcctttattggcgtacctgtatgggttatcaatcat
ggaattgattgggcggaaataggcactgcgatcttcttattttatttcactggtatgtca
attactgccggttaccatcgtctgtggtcacataaaacctatgatgcgaatattgtcgtg
cgcgtaatacttgctatcggcggcgcaatggcactgcaaaatagtattttgcactggagt
tcagatcacagaattcaccaccgtcacgttgacgacaacgacaaagacccttattcagca
aagcgcggtttgtggtttgcacacattggttggatgcttcgcgagtatcaagaaaagcga
tatgacgactacagaaactgtaaagacttgcagaaagataaagtggttatgtggcaacac
aattactacttacctatcgttcttgccgcgaacttcggcgttaccggctttttgggttgg
ttgaatggtgacatcttaggcatgattttggtggctggcgtattgcgcttggtacttgtg
catcatgtaaccttctttattaattccttagcacatttctggggaaaccagccgtatact
gatgcaaatacggctagagataacggtgtactagcattcttcactttcggcgagggttat
cacaactatcaccatatttttgaatacgactaccgtaacggtattcgttggtatcagttt
gatccaacaaaatggttaatccgcgggctttcttacgtgggacttacccataacctgcgt
cgtgtgcccgaagagcgtattgaaaaagcgagagcggcaatgcaactgcaacgtgctagc
gaacaagtctctgtattaccgaatgcagaagagctcatgcacaccattgagcaagagtat
gagctacttatgcaacgtatgtctgattactacgcggcgaaaaagcgtttgatgaaagta
aaacaaaaatcactcaaacgtaccatagaaggcttagagcttacctataagtataaagag
cttaagcatgcgttagccgtacaaaaagaaaagtggcttcagttacagagtctatcgctt
caagccgcataa

DBGET integrated database retrieval system