KEGG   Alteromonas sp. SN2: ambt_01420Help
Entry
ambt_01420        CDS       T01513                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
alt  Alteromonas sp. SN2
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:alt00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:alt00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:alt03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:alt03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:alt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
342142..342567
Genome map
AA seq 141 aa AA seqDB search
MPQVVFYQLSAGDTSVASRASELIADAFANKQKISVLCDTQKQAEEVDEFLWQLPANRFV
PHNLYGEGPQSGTPVEICWQPEQVARRQMVVNVGSGMVPSPNQHRQIIDFVPVDDEAKQA
ARVRYKNYQQAGCNMQFKKTA
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaagtcgtgttttatcaactgagcgcaggcgacaccagtgtggcgtctcgcgcg
agcgaacttattgcagatgcttttgccaacaagcaaaagataagcgtgttatgcgatacg
caaaagcaagccgaagaagttgatgaatttttatggcaattgccagccaatcgctttgta
ccccacaacctatatggtgaagggccacaaagcggcacaccggtggaaatttgttggcaa
cccgagcaggttgcccgccgtcaaatggtggttaacgttggttcgggcatggtgccttcg
ccaaatcaacatcgccaaattatcgattttgttcccgtagatgacgaagccaaacaggct
gcgcgggtgcgatataagaactaccagcaagccggatgtaatatgcagtttaagaaaact
gcatag

DBGET integrated database retrieval system