KEGG   Alteromonas sp. SN2: ambt_01420Help
Entry
ambt_01420        CDS       T01513                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
alt  Alteromonas sp. SN2
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ambt_01420
   00240 Pyrimidine metabolism
    ambt_01420
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ambt_01420
   03430 Mismatch repair
    ambt_01420
   03440 Homologous recombination
    ambt_01420
Enzymes [BR:alt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ambt_01420
DNA replication proteins [BR:alt03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ambt_01420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
342142..342567
Genome map
AA seq 141 aa AA seqDB search
MPQVVFYQLSAGDTSVASRASELIADAFANKQKISVLCDTQKQAEEVDEFLWQLPANRFV
PHNLYGEGPQSGTPVEICWQPEQVARRQMVVNVGSGMVPSPNQHRQIIDFVPVDDEAKQA
ARVRYKNYQQAGCNMQFKKTA
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaagtcgtgttttatcaactgagcgcaggcgacaccagtgtggcgtctcgcgcg
agcgaacttattgcagatgcttttgccaacaagcaaaagataagcgtgttatgcgatacg
caaaagcaagccgaagaagttgatgaatttttatggcaattgccagccaatcgctttgta
ccccacaacctatatggtgaagggccacaaagcggcacaccggtggaaatttgttggcaa
cccgagcaggttgcccgccgtcaaatggtggttaacgttggttcgggcatggtgccttcg
ccaaatcaacatcgccaaattatcgattttgttcccgtagatgacgaagccaaacaggct
gcgcgggtgcgatataagaactaccagcaagccggatgtaatatgcagtttaagaaaact
gcatag

DBGET integrated database retrieval system