KEGG   Alteromonas sp. SN2: ambt_01725Help
Entry
ambt_01725        CDS       T01513                                 

Definition
methylcitrate synthase
Orthology
K01659  
2-methylcitrate synthase [EC:2.3.3.5]
Organism
alt  Alteromonas sp. SN2
Pathway
Propanoate metabolism
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:alt00640]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(413214..414338)
Genome map
AA seq 374 aa AA seqDB search
MAKQLSGAGLRGQVAGKTALSTVGVSGSGLTYRGYDVKDLAASCQFEEVAYLILKGKLPT
QSELDEYKALLRSMRGLPQALKDVLERIPKDAHPMDVLRTGCSMLGNLEMENDFSEQQQA
TDRMLACFPSIICYWYRFTHDGVRIDVETDDDSIGGHFLHMLHGEKPRELHEQVMHVSLI
LYAEHEFNASTFTARVCASTLSDMHSCVTGAIGSLRGPLHGGANEAAMEMIEGFTSADDA
EEKMMAMLARKDKIMGFGHAIYSESDPRNEIIKGWSEKLAADVGDEVLYPVSVRCEEVMW
REKKLFCNADFFHASAYNFMGIPTKLFTPIFVMSRLTGWAAHVMEQRADNRIIRPSAEYT
GEDIRDVPPMSARS
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacaattaagtggcgcgggattacgcggccaagttgcaggaaaaacagcactg
tctactgtaggcgtatcaggttctggcctgacataccgtggttacgatgtaaaagattta
gcagccagttgccagtttgaagaagtggcttatcttattttaaaaggtaaattgcctacc
cagtccgagttagatgaatacaaagccttacttcgaagtatgcgcggattgcctcaggct
cttaaagatgtattagagcgtattccaaaagacgcacatcctatggacgtacttcgtaca
ggttgttctatgttgggcaaccttgaaatggaaaacgatttcagcgaacagcagcaagca
actgatcgtatgttagcttgtttcccaagcattatttgctattggtatcgctttactcac
gatggcgttcgtattgatgtagaaaccgatgacgattcaatcggtggtcatttcttgcat
atgctgcacggcgaaaaaccacgtgagctacatgaacaagtcatgcacgtttcacttatt
ttgtacgcagagcacgaattcaatgcctctacctttaccgctcgcgtatgtgcctcaacc
ttgtcagatatgcactcatgtgtcaccggcgctattggctcacttcgcggtccattgcat
ggcggtgcgaatgaagcagctatggaaatgattgaaggctttacctcggcagacgacgct
gaagaaaaaatgatggccatgcttgcccgtaaagacaaaatcatgggctttggccatgcc
atttattctgaatctgaccctcgcaacgaaatcatcaaaggctggtctgaaaagctcgct
gccgatgtaggtgacgaggtactttaccccgtatctgtgcgctgtgaagaagtgatgtgg
cgcgagaaaaagctattctgtaacgctgattttttccacgcttccgcctataactttatg
ggaatccccaccaagttgtttacccctatcttcgtgatgtctcgcctaacgggctgggca
gcacacgtgatggaacaacgcgctgacaaccgtattattcgcccatcagctgaatatact
ggtgaagatattcgtgacgtacctcctatgtctgcacgtagttaa

DBGET integrated database retrieval system