KEGG   Alteromonas sp. SN2: ambt_01960Help
Entry
ambt_01960        CDS       T01513                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
alt  Alteromonas sp. SN2
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ambt_01960
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ambt_01960
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ambt_01960
Enzymes [BR:alt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ambt_01960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
460129..461415
Genome map
AA seq 428 aa AA seqDB search
MELVNLKDAQDTASFAEAVKRGLGKQQGLYFPTHIPKLDNIDELLEMPFAARSIAVLRAI
IGDELNNGELEEIVNTAFAFGAPVEQVSDNIYTLELFHGPTLAFKDFGGRFMAQTLSRIS
EGKPVTILTATSGDTGAAVAHAFHGIENINVVILFPKGKISALQEKLFTTLGGNIHTVAV
ESDFDECQSLVKASFDDPDIREGLHLNSANSINISRLLAQVCYYFEAVSQLPKDKRDQLV
ISVPSGNFGNLTAGMIAKSMGLPIKRFIAATNANDTVPRYLKTGEWAPKKTVATMSNAMD
VSQPNNWPRIEALIEQGYVDKGCLKGEMVDEEYTQLAMRQLAQLGYTSEPHAAIAYRAVS
HDLEDGEIGLFLGTAHPAKFRETVENVLGTPISLPKPLADVAGEDSLAVDLPASYDALKQ
HMLDLLKA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtggaattggttaatttaaaagatgcacaggacactgcctcatttgccgaagcagttaaa
agagggttgggtaagcaacaaggtttgtatttcccgacgcatattccaaagctagataat
attgatgaactgcttgaaatgccgttcgcggcgcgcagcatagcggtacttcgtgccatt
attggtgatgagcttaacaatggcgaattagaagaaatcgtgaataccgcgtttgctttt
ggcgcgccggtagagcaggtaagcgacaatatttatactttggagcttttccacggacca
acgttggcgtttaaagattttggtggtcgcttcatggcgcaaaccctatcaagaattagt
gaaggtaaaccagtcactattcttaccgccacttctggtgatacaggtgctgcggtagcg
catgcgtttcacggtattgaaaatatcaatgtggtcattcttttccctaaaggcaaaatt
agcgccctgcaagaaaagctgttcaccactcttggtggcaatatccatacagtagctgtt
gaatctgattttgatgaatgtcagtccttagtaaaagcatcattcgacgacccagacatc
cgtgaaggtttacaccttaactcggctaactcgattaatatcagtcgcttgctagcccaa
gtatgttattactttgaagcggtaagccaattacctaaagataagcgtgatcaactagtt
atctctgtaccaagtggaaactttggtaacttaaccgccggtatgattgcaaaatcaatg
ggcttgccaattaaacgctttatcgctgccactaacgctaatgatactgtgccacgctat
ttaaaaactggcgagtgggcgccgaagaagactgtcgctactatgtcgaacgcgatggat
gttagccaacctaacaactggccgcgcattgaagccttaatcgagcagggctatgttgat
aaaggctgcttaaaaggcgaaatggtagatgaagagtacactcagctagctatgcgccaa
ttagcgcaattaggctataccagtgagcctcatgctgctattgcttaccgtgcagttagc
cacgatttagaagacggcgaaattggcctattcttaggtactgcgcatcctgcgaaattc
cgcgaaacggtagaaaacgtgctgggcacgcctattagcttgcctaagccgttagctgat
gtagccggtgaagacagccttgctgttgatttgcctgcatcttacgatgcgcttaaacag
cacatgttggatttactaaaagcgtga

DBGET integrated database retrieval system