KEGG   Alteromonas sp. SN2: ambt_02180Help
Entry
ambt_02180        CDS       T01513                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
alt  Alteromonas sp. SN2
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ambt_02180
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ambt_02180
Enzymes [BR:alt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     ambt_02180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
510151..511743
Genome map
AA seq 530 aa AA seqDB search
MVVNSFIQSTRALLAKFGIDAPDIRIEGLTLDSRDVNTKTAFVAVKGHERDGRDFIPQAI
SLGARVILAQTDDSQAHGQMEMRDHSVIISLYQLPSMLSALAAAFYDYPALKMMTVAVTG
TNGKTSTVQLLTQLKDALGTRSASVGTLGSSVYEGENTQWVTTAAANTTPNAIRLQYVLA
EFVQCEVRHTAFEASSHALVQGRLSQVKTDIAVFTNLTRDHLDYHGTMEEYAKAKRLLLD
QPGLEAVVLNVNDSESQNWADYLDANAAKDGSSEEIAISKPRVTRVWTGFEPTDDVLATH
KQPQDRHCFATNVSYHSSGIRFDLVSSWGTAPIELALFGSFNVSNTLSAISCLLAQGERF
ENVVRVVNGLQPVPGRMEVFPVGGSASVIVDYAHTPDALEQVLKSAKTHTAGKVWCVFGC
GGDRDKGKRPLMGAAAEQHADVIVITTDNSRSESPESIASDIKAGLQRPNDAVEEADRES
AIRYCLDSADENDIIIVAGKGHEDYQIIGTQQTDYNERTVVARLQQEYKK
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
gtggtagttaattcctttattcaaagtacgcgtgcgctgttagcaaagtttggcatagac
gcgccagatattcgtattgaaggcctaactttagatagccgtgatgtgaacacaaaaaca
gcatttgtagcggttaaaggtcatgagcgtgacggaagagatttcataccacaggcaatt
agtttaggcgcgcgtgtcattctggcgcaaactgacgacagtcaagcccatggccaaatg
gaaatgcgcgaccattcggtaattatttcgctatatcaattacctagcatgctatcggca
ttggcggctgcattttacgattaccccgctttgaaaatgatgacagtggcggtaacggga
actaacggaaaaacctcgacagttcaattgcttacccagttaaaagatgcgctaggtacg
cgcagtgcaagcgttggcactcttggcagtagcgtatatgaaggtgaaaatacccaatgg
gttacgaccgccgcggctaataccacccctaatgctattcgtttgcagtacgtgttggca
gagtttgtgcaatgcgaagtgcgacatacggcgtttgaagccagctctcatgcattagtg
caaggccggttaagccaagtgaaaacggatattgcagtattcaccaacttaacgcgagac
catcttgattatcacggcaccatggaagagtacgctaaggcaaaacgtttgttgttagat
caacctggccttgaagctgttgtattgaatgtaaacgacagtgaaagccagaattgggct
gactacttagacgctaatgcagctaaagatggaagctcagaagaaatagcaattagtaag
ccgagagtgacacgagtatggacagggtttgaacctactgatgatgttttagccacgcac
aaacaaccacaagatcgccattgtttcgccacaaatgtttcataccattcttcaggaatt
cgattcgaccttgtttcttcatggggcacagcacctattgaattggcattgtttggctcg
tttaacgtgagcaatacgctaagcgctatttcatgtttattggcgcagggcgaacgcttt
gaaaatgtagtgcgggtagtgaatggtttgcaacctgtaccgggaagaatggaagtgttc
cccgttgggggtagtgccagcgtaattgttgattatgcgcacacgccagacgcgttagaa
caagtgctgaaaagcgctaaaacacatactgccggcaaagtgtggtgcgtgtttgggtgt
ggtggcgatcgcgataaaggcaagcgtcccttaatgggcgcggcggctgaacagcatgct
gacgtaattgtcattaccactgacaacagtcgtagcgagtcgccagaaagtattgctagc
gatattaaggcgggcttgcaacgccctaatgacgcagttgaagaagcagacagagaaagc
gctattcgctattgcttagatagtgcagatgagaacgacattattatagtggccggtaaa
ggccatgaagattaccaaattattggtacccaacagacagactataacgaacgtacagtt
gtggcgcgactacagcaggagtacaaaaaatga

DBGET integrated database retrieval system