KEGG   Alteromonas sp. SN2: ambt_02320Help
Entry
ambt_02320        CDS       T01513                                 

Definition
pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
alt  Alteromonas sp. SN2
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ambt_02320
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ambt_02320
   00020 Citrate cycle (TCA cycle)
    ambt_02320
   00620 Pyruvate metabolism
    ambt_02320
Enzymes [BR:alt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ambt_02320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
542946..544976
Genome map
AA seq 676 aa AA seqDB search
MSDIQKIIVPDVGGDEVEVIELCVAVGDTIDADEGVVTVESDKASMDIPAPFEGEIVSLS
VAVGDKIKEGDVIGEMKKAGGEEASSEEKEEPAEAAPAPEEPKEEPKEESKSEAAPASSG
GEVIEVAVPDIGDDGEVDVIDVLVSVGDTIEKEDGLITLETDKATMDVPSTHAGTVKEVF
ISTGDKVKEGTLVIKLETAGSGEAASSDAPAQSSSEKAAPSAESSSDDAASSAPSSESAG
GVVEVEVPDIGEDGEVDVIDVLVSVGDIIEKEDGLITLETDKATMDVPSTHAGTVKEVFI
KAGDKVKQGTLVIKLETAGSGGSASSEAPAPKKAESAPEKPKAADKPAAQNKSPVPPQES
PEPKGNGKAHASPSVRRVAREFGVDLTLVNGTGPKNRILKEDVQAYVKAELAKPKGSAAS
AAAPAGDNVLQIVPVKPVDHSKFGEVEEVKLSRIQKISGPFLHRNWATIPHVTQFDEADI
TDVEAFRKEQNAYHAKIKSGLKITPLVFIMKAVAKALEKYEVFNSSLSDDGESLIIKKFI
NIGIAVETPGGLVVPVIKDVNKKGIEQLSQELIETSKKARDGKLKSSDMQGGTFTISSLG
GIGGTAFTPIVNAPEVAILGVSKSDMKPKWNGSEFEPRLMVPLSLSYDHRVIDGAVGARF
SAEVAANLTDLRRIIL
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatattcaaaagattatcgtaccggatgtaggcggtgacgaagttgaagttatc
gagctatgtgttgccgtaggcgacaccattgatgcagatgaaggcgttgttactgtagaa
agtgacaaagcctctatggatattcctgcaccatttgaaggtgaaatcgttagcttatct
gttgccgttggcgacaagattaaagaaggcgatgttatcggcgaaatgaaaaaagcaggt
ggcgaagaagcctcttctgaagagaaagaagagccagctgaagcagcgcctgcaccagaa
gagccgaaagaagaacctaaagaagaaagtaaatcagaagcggcaccagcatcatcaggt
ggtgaagtgatagaagttgcggttcctgatattggtgacgacggcgaagtagatgttatt
gatgtattggtttctgtaggcgataccatcgaaaaagaagatgggcttattacgctagaa
accgacaaagccactatggatgtgccttctactcacgcaggtactgtgaaagaagtattc
atcagtactggcgataaagtaaaagaaggtacgctagttattaaactagaaaccgctgga
agtggtgaagcagctagcagtgatgcgcctgctcagtcaagttctgaaaaagcggcacct
tcggctgaatcatcttctgacgacgcggcttcatctgccccgtcatcagaatctgccggt
ggcgtagtagaagttgaagtacctgatattggcgaagacggtgaagtagacgttatcgat
gtattagtttctgtgggcgacatcattgagaaagaagatggtcttattacccttgaaact
gataaagcgacaatggatgtgccttctacccatgcaggtacagtaaaagaagtcttcatt
aaggccggtgacaaagttaagcaaggtacgctagttattaagctggaaactgccggaagt
ggcggttcagcaagtagcgaagcacctgcaccgaagaaagcggaatctgcgcctgagaag
cccaaagcggctgacaaaccagcagcacagaataagtcacctgttccaccacaggaatca
cctgagcctaaaggcaatggtaaagcacatgcttcaccttcagtgcgccgcgtagcaaga
gagtttggtgtagaccttacccttgttaatggaacaggccctaagaatcgtattcttaaa
gaagacgttcaggcttacgtgaaagctgaacttgctaagccgaaaggcagtgctgcaagt
gccgctgcaccagcaggcgataacgtacttcaaattgtgccggttaaacctgttgatcac
agcaagtttggcgaagttgaagaagttaagctgtcgcgtattcaaaagatttctggtccg
ttcttacaccgtaactgggcgactatccctcatgtaacacagtttgatgaggctgatatc
accgacgtagaagcgttccgtaaagaacaaaatgcgtatcatgcgaaaattaagtctggc
ttgaagatcacgccacttgttttcatcatgaaagcggtcgcaaaagcactagagaaatac
gaagtatttaactcttcgctttctgatgatggtgaaagcttgattatcaagaagttcatc
aacattggtattgcggtagaaacgccaggtggcttggtagtgccggtaatcaaagacgtg
aacaagaaaggtattgagcagttgtctcaagagcttattgaaacgtcgaagaaagcacgc
gacggcaagctgaagtcttcagatatgcaaggcggtaccttcaccatttcaagtttaggc
ggaattggcggaacagcgttcacaccaattgtgaatgcccctgaagttgctatcttaggt
gtgtctaagtctgatatgaaaccgaagtggaatggtagcgagtttgaacctcgtctaatg
gttccattaagtttatcttacgaccaccgtgttatcgatggcgcagtaggtgcaaggttc
tctgctgaagtggcagcaaacttaactgacttgcgcagaattatactttaa

DBGET integrated database retrieval system