KEGG   Alteromonas sp. SN2: ambt_03030Help
Entry
ambt_03030        CDS       T01513                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
alt  Alteromonas sp. SN2
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ambt_03030
Enzymes [BR:alt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     ambt_03030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
703562..705043
Genome map
AA seq 493 aa AA seqDB search
MPLRNGVQLITYADRLGKGNMTGLNTLLSTTLKGLFTGVHILPFYYPFDGEDAGFDPIDH
TTVDSRLGSWADVKQIGESMNIMADLIVNHMSAQSEPFLDVIKNGRESQYWPLFLTKQSV
FSEDDAANIANIGKVFRPRPTPFFSEYELDNKEVVPFWTTFTANQIDIDVESDLGKAYLE
SILEAFTQSNVDLIRLDAAGYAIKRAGTNCFMLEETFEFIEALSKRAHAMGIQSLVEIHS
HFETQIAIASRCDSVYDFALPPLVLHTLFSKDASALAHWLSISPRNCFTVLDTHDGIGIV
DVGASGDKPGLLTNSQIDNLVETIHVNSNGESRKATGEAASNVDLYQINCTYYDALGKDD
YKYLLARAIQFFSPGVPQVYYAGMLGATNDMELLAKTNVGRDINRPYLSESDIDEALAKP
VVKGLIELIHIRNDTNAFNGDFSVTEDAGTLLLVWTLGEDRAELRIEMSTLDATITLLEG
GLKSALSLAKFTA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcctttacgcaatggcgttcaacttattacctatgcagaccgtttaggtaagggaaat
atgacaggcctcaacacgctgctaagcaccacgttgaaagggctatttacgggcgttcat
attttacctttctattaccccttcgatggtgaagatgcaggttttgatcctatcgatcac
actaccgttgattcgcgcttgggcagctgggccgatgtgaaacagattggtgagtcgatg
aatattatggcagacctaatagtgaatcatatgtctgcgcaaagtgagccgtttttagat
gtgattaaaaatggacgagagtctcagtactggccgctatttttaacaaaacaatctgta
tttagcgaagatgatgcggctaatattgccaatatcggaaaggtatttaggcctcgccct
acgccatttttctctgagtatgagctagataacaaagaggttgtgcctttctggacaacg
ttcaccgccaatcaaatcgatattgatgttgagtctgacttgggtaaagcatacctagaa
tcaatcctagaagcttttacacaaagtaatgtcgatttaattcgtttagatgcagcaggt
tatgccattaaacgcgctggcactaactgtttcatgttagaagaaacctttgagtttatc
gaagcattaagcaagcgtgcacacgcgatgggcattcaaagcttggttgaaattcacagc
cattttgaaactcagattgctattgcgtctcgttgtgacagcgtttacgactttgcgctt
ccaccattggtattgcacaccctatttagcaaagacgcatctgccttggcgcattggttg
tctatttcccctcgcaattgcttcaccgtactagatacccatgatggaattggtattgtt
gatgtaggagccagcggtgataagccagggcttttaactaactcgcaaatcgataatttg
gtagaaaccattcatgttaactcgaatggagagtcgagaaaggccactggggaagctgca
agtaatgtcgacctgtatcaaattaactgcacttattatgatgcactaggaaaagacgac
tataaatacttgcttgcgcgtgcgatacagtttttcagtccaggggtaccacaagtatat
tatgctgggatgctaggggcgactaacgacatggaactgctagcgaaaaccaatgtgggt
cgtgatatcaatagaccttatttaagtgagagcgatattgatgaagccctcgctaagcca
gtggtaaaaggcctaattgaattaattcatattcgcaacgataccaatgcgtttaacggc
gatttctctgttactgaagatgcaggtactttgttattagtctggacgttaggtgaagac
cgcgccgaattacggatagaaatgagcacgcttgatgcaactatcacattgctagaaggc
ggacttaaatccgccctatctttagcaaaatttacggcatag

DBGET integrated database retrieval system