KEGG   Alteromonas sp. SN2: ambt_03715Help
Entry
ambt_03715        CDS       T01513                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
alt  Alteromonas sp. SN2
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ambt_03715
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ambt_03715
   00630 Glyoxylate and dicarboxylate metabolism
    ambt_03715
Enzymes [BR:alt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ambt_03715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(858974..861160)
Genome map
AA seq 728 aa AA seqDB search
MQNYITRGRLQVAEQLDDFINQKAMPGTGVQSDAFWQGAEALFSEFVPQNRALLEKREQL
QRAIDDYHKAGNPAFGEQYITFLKEIGYLVEQPEKVQADTTNVDAEIATMAGPQLVVPIN
NARYALNAVNARWGSLYDALYGTDVISNENGAEPGKSYNPIRGEKVVAKAKSYLDSMLPL
AKGSHADVVGYKIETGKLAISLTDGDITTLANTEQWQGYQGDITAPTALLFVHNGLHFEI
QIDATSPIGKTDAAGVKDVLIEAALTTIMDCEDSVAAVDAEDKTLVYSNWLGLMKGSLSI
EMSKGGKTIVRAMHEDRVYSPSKHVTNQEQLSLSARSLMFVRNVGHLMTNDAMLFDGEPV
PEGIMDGLVTSLIAKHDLLNNSPFQNSRHGSIYIVKPKMHGPEEVAFSDALFAKIETVIN
VPKNTLKMGIMDEERRTSVNLDACINAAKSRVVFINTGFLDRTGDEIHTSMLAGPFAEKA
TLKTMLWIKAYETANVAVGLRCGLSGKAQIGKGMWPIPDEMQNMMDAKIGHPKSGANTAW
VPSPTAATLHALHYHDVNVFDIQKGLDQDFSGLNDILTIPLLESRDSLSADTIQREIDNN
VQGILGYVVRWVHQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLEHGIVSAAQVDES
LRRMAKLVDEQNAGDAEYIPMMPDLDSSIGFLAASDLIFKGKEQPSGYTEPLLHARRREM
KAKLVSVK
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaattatattacacgaggccgtttacaggttgctgagcaactcgatgatttcatc
aaccaaaaggcaatgccaggcactggtgttcaatcagacgctttttggcaaggtgcagaa
gccctcttttcagaattcgttcctcaaaatcgtgccctgctagaaaaaagagaacaactc
caacgcgctatcgatgactatcacaaagcgggaaaccccgctttcggtgagcaatatata
actttcttaaaagaaattggttacttagtagagcagcctgaaaaggtacaagccgatacc
acaaacgtggatgcagaaattgctactatggctggccctcaattagttgtaccaattaac
aacgcccgttatgcactgaatgctgttaatgctcgctgggggagtttgtatgatgcttta
tacggcactgatgttattagcaacgagaacggagcagaacccggcaaaagctataaccct
atccgtggcgagaaagtggtagcgaaagcgaaaagctatttagatagtatgcttccactt
gcaaaaggaagccacgcagatgttgtcggttataaaatagaaacaggcaaattggcgatt
tccttaactgatggcgacatcactacacttgcgaacaccgagcaatggcaaggttaccaa
ggtgatataacagctcctactgcgctgttattcgttcacaacggcctgcattttgaaatt
cagatagatgccaccagccctatcggtaaaactgacgccgctggcgttaaagatgtgctg
attgaggctgcattgactaccatcatggattgcgaagactcagtcgccgctgttgatgcc
gaagataaaaccttggtttatagcaactggttagggctaatgaaaggctcgctaagcatt
gaaatgagtaaaggtggcaaaactatcgttcgggctatgcatgaagatagagtgtattcg
ccttccaaacatgtaacgaatcaagagcaactatctttatctgcgcgcagccttatgttt
gtacgtaacgtaggtcatttaatgacaaacgacgcgatgctattcgatggtgagccagta
ccagaaggtattatggacggtttagtgacttcgcttatcgccaagcatgacttactgaat
aacagtccattccaaaactctcgtcatggcagcatttatattgttaaacccaaaatgcat
ggccctgaagaagtggctttttctgatgcgctattcgccaaaatagaaaccgtcatcaat
gtgcctaaaaacacgttgaaaatgggtattatggatgaagaacgccgcaccagcgtgaat
ttagacgcctgcatcaatgctgcgaagtctcgcgttgtatttattaatacaggcttttta
gacagaacaggcgatgaaattcatacgtctatgcttgcaggccctttcgccgaaaaagcg
acccttaagacgatgctgtggattaaagcctatgaaaccgcaaatgtagccgtcggcctt
cgatgtggcctgtcaggtaaggcgcaaattggcaagggcatgtggccaattcccgatgaa
atgcaaaatatgatggatgccaaaattggacatccaaagtctggtgcaaataccgcatgg
gtaccctcacctaccgctgccactttgcatgcgctgcattatcatgatgttaatgtcttc
gacattcagaagggattagatcaagatttctcaggccttaacgatattttgactattcca
ctgctagaaagtagagattcactatcagccgacacgatacagcgggaaatagataataat
gtgcaaggtatcttaggttacgtggttcgttgggtacatcagggagtaggctgctctaaa
gtacctgatattaataatgttgggctgatggaagacagagctacactccgtatttcatcg
cagcacatcgctaactggcttgagcacggcattgtaagtgccgcgcaagttgatgaatcc
cttcgcagaatggcaaagttagttgatgagcaaaatgctggcgacgcagaatatatccct
atgatgcctgatttagatagctcaattggtttcttagccgctagcgatcttatctttaaa
gggaaagaacagccaagtggttataccgagcctttattgcacgcaagacgccgcgaaatg
aaagcgaagttagtctctgtaaaatag

DBGET integrated database retrieval system