KEGG   Alteromonas naphthalenivorans: ambt_03715Help
Entry
ambt_03715        CDS       T01513                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
alt  Alteromonas naphthalenivorans
Pathway
alt00620  Pyruvate metabolism
alt00630  Glyoxylate and dicarboxylate metabolism
alt01100  Metabolic pathways
alt01110  Biosynthesis of secondary metabolites
alt01120  Microbial metabolism in diverse environments
alt01200  Carbon metabolism
Module
alt_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ambt_03715
   00630 Glyoxylate and dicarboxylate metabolism
    ambt_03715
Enzymes [BR:alt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ambt_03715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AEF02293
UniProt: F5ZAT3
Position
complement(858974..861160)
Genome map
AA seq 728 aa AA seqDB search
MQNYITRGRLQVAEQLDDFINQKAMPGTGVQSDAFWQGAEALFSEFVPQNRALLEKREQL
QRAIDDYHKAGNPAFGEQYITFLKEIGYLVEQPEKVQADTTNVDAEIATMAGPQLVVPIN
NARYALNAVNARWGSLYDALYGTDVISNENGAEPGKSYNPIRGEKVVAKAKSYLDSMLPL
AKGSHADVVGYKIETGKLAISLTDGDITTLANTEQWQGYQGDITAPTALLFVHNGLHFEI
QIDATSPIGKTDAAGVKDVLIEAALTTIMDCEDSVAAVDAEDKTLVYSNWLGLMKGSLSI
EMSKGGKTIVRAMHEDRVYSPSKHVTNQEQLSLSARSLMFVRNVGHLMTNDAMLFDGEPV
PEGIMDGLVTSLIAKHDLLNNSPFQNSRHGSIYIVKPKMHGPEEVAFSDALFAKIETVIN
VPKNTLKMGIMDEERRTSVNLDACINAAKSRVVFINTGFLDRTGDEIHTSMLAGPFAEKA
TLKTMLWIKAYETANVAVGLRCGLSGKAQIGKGMWPIPDEMQNMMDAKIGHPKSGANTAW
VPSPTAATLHALHYHDVNVFDIQKGLDQDFSGLNDILTIPLLESRDSLSADTIQREIDNN
VQGILGYVVRWVHQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLEHGIVSAAQVDES
LRRMAKLVDEQNAGDAEYIPMMPDLDSSIGFLAASDLIFKGKEQPSGYTEPLLHARRREM
KAKLVSVK
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaattatattacacgaggccgtttacaggttgctgagcaactcgatgatttcatc
aaccaaaaggcaatgccaggcactggtgttcaatcagacgctttttggcaaggtgcagaa
gccctcttttcagaattcgttcctcaaaatcgtgccctgctagaaaaaagagaacaactc
caacgcgctatcgatgactatcacaaagcgggaaaccccgctttcggtgagcaatatata
actttcttaaaagaaattggttacttagtagagcagcctgaaaaggtacaagccgatacc
acaaacgtggatgcagaaattgctactatggctggccctcaattagttgtaccaattaac
aacgcccgttatgcactgaatgctgttaatgctcgctgggggagtttgtatgatgcttta
tacggcactgatgttattagcaacgagaacggagcagaacccggcaaaagctataaccct
atccgtggcgagaaagtggtagcgaaagcgaaaagctatttagatagtatgcttccactt
gcaaaaggaagccacgcagatgttgtcggttataaaatagaaacaggcaaattggcgatt
tccttaactgatggcgacatcactacacttgcgaacaccgagcaatggcaaggttaccaa
ggtgatataacagctcctactgcgctgttattcgttcacaacggcctgcattttgaaatt
cagatagatgccaccagccctatcggtaaaactgacgccgctggcgttaaagatgtgctg
attgaggctgcattgactaccatcatggattgcgaagactcagtcgccgctgttgatgcc
gaagataaaaccttggtttatagcaactggttagggctaatgaaaggctcgctaagcatt
gaaatgagtaaaggtggcaaaactatcgttcgggctatgcatgaagatagagtgtattcg
ccttccaaacatgtaacgaatcaagagcaactatctttatctgcgcgcagccttatgttt
gtacgtaacgtaggtcatttaatgacaaacgacgcgatgctattcgatggtgagccagta
ccagaaggtattatggacggtttagtgacttcgcttatcgccaagcatgacttactgaat
aacagtccattccaaaactctcgtcatggcagcatttatattgttaaacccaaaatgcat
ggccctgaagaagtggctttttctgatgcgctattcgccaaaatagaaaccgtcatcaat
gtgcctaaaaacacgttgaaaatgggtattatggatgaagaacgccgcaccagcgtgaat
ttagacgcctgcatcaatgctgcgaagtctcgcgttgtatttattaatacaggcttttta
gacagaacaggcgatgaaattcatacgtctatgcttgcaggccctttcgccgaaaaagcg
acccttaagacgatgctgtggattaaagcctatgaaaccgcaaatgtagccgtcggcctt
cgatgtggcctgtcaggtaaggcgcaaattggcaagggcatgtggccaattcccgatgaa
atgcaaaatatgatggatgccaaaattggacatccaaagtctggtgcaaataccgcatgg
gtaccctcacctaccgctgccactttgcatgcgctgcattatcatgatgttaatgtcttc
gacattcagaagggattagatcaagatttctcaggccttaacgatattttgactattcca
ctgctagaaagtagagattcactatcagccgacacgatacagcgggaaatagataataat
gtgcaaggtatcttaggttacgtggttcgttgggtacatcagggagtaggctgctctaaa
gtacctgatattaataatgttgggctgatggaagacagagctacactccgtatttcatcg
cagcacatcgctaactggcttgagcacggcattgtaagtgccgcgcaagttgatgaatcc
cttcgcagaatggcaaagttagttgatgagcaaaatgctggcgacgcagaatatatccct
atgatgcctgatttagatagctcaattggtttcttagccgctagcgatcttatctttaaa
gggaaagaacagccaagtggttataccgagcctttattgcacgcaagacgccgcgaaatg
aaagcgaagttagtctctgtaaaatag

DBGET integrated database retrieval system