KEGG   Alteromonas sp. SN2: ambt_03715Help
Entry
ambt_03715        CDS       T01513                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
alt  Alteromonas sp. SN2
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ambt_03715
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ambt_03715
   00630 Glyoxylate and dicarboxylate metabolism
    ambt_03715
Enzymes [BR:alt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ambt_03715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(858974..861160)
Genome map
AA seq 728 aa AA seqDB search
MQNYITRGRLQVAEQLDDFINQKAMPGTGVQSDAFWQGAEALFSEFVPQNRALLEKREQL
QRAIDDYHKAGNPAFGEQYITFLKEIGYLVEQPEKVQADTTNVDAEIATMAGPQLVVPIN
NARYALNAVNARWGSLYDALYGTDVISNENGAEPGKSYNPIRGEKVVAKAKSYLDSMLPL
AKGSHADVVGYKIETGKLAISLTDGDITTLANTEQWQGYQGDITAPTALLFVHNGLHFEI
QIDATSPIGKTDAAGVKDVLIEAALTTIMDCEDSVAAVDAEDKTLVYSNWLGLMKGSLSI
EMSKGGKTIVRAMHEDRVYSPSKHVTNQEQLSLSARSLMFVRNVGHLMTNDAMLFDGEPV
PEGIMDGLVTSLIAKHDLLNNSPFQNSRHGSIYIVKPKMHGPEEVAFSDALFAKIETVIN
VPKNTLKMGIMDEERRTSVNLDACINAAKSRVVFINTGFLDRTGDEIHTSMLAGPFAEKA
TLKTMLWIKAYETANVAVGLRCGLSGKAQIGKGMWPIPDEMQNMMDAKIGHPKSGANTAW
VPSPTAATLHALHYHDVNVFDIQKGLDQDFSGLNDILTIPLLESRDSLSADTIQREIDNN
VQGILGYVVRWVHQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLEHGIVSAAQVDES
LRRMAKLVDEQNAGDAEYIPMMPDLDSSIGFLAASDLIFKGKEQPSGYTEPLLHARRREM
KAKLVSVK
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaattatattacacgaggccgtttacaggttgctgagcaactcgatgatttcatc
aaccaaaaggcaatgccaggcactggtgttcaatcagacgctttttggcaaggtgcagaa
gccctcttttcagaattcgttcctcaaaatcgtgccctgctagaaaaaagagaacaactc
caacgcgctatcgatgactatcacaaagcgggaaaccccgctttcggtgagcaatatata
actttcttaaaagaaattggttacttagtagagcagcctgaaaaggtacaagccgatacc
acaaacgtggatgcagaaattgctactatggctggccctcaattagttgtaccaattaac
aacgcccgttatgcactgaatgctgttaatgctcgctgggggagtttgtatgatgcttta
tacggcactgatgttattagcaacgagaacggagcagaacccggcaaaagctataaccct
atccgtggcgagaaagtggtagcgaaagcgaaaagctatttagatagtatgcttccactt
gcaaaaggaagccacgcagatgttgtcggttataaaatagaaacaggcaaattggcgatt
tccttaactgatggcgacatcactacacttgcgaacaccgagcaatggcaaggttaccaa
ggtgatataacagctcctactgcgctgttattcgttcacaacggcctgcattttgaaatt
cagatagatgccaccagccctatcggtaaaactgacgccgctggcgttaaagatgtgctg
attgaggctgcattgactaccatcatggattgcgaagactcagtcgccgctgttgatgcc
gaagataaaaccttggtttatagcaactggttagggctaatgaaaggctcgctaagcatt
gaaatgagtaaaggtggcaaaactatcgttcgggctatgcatgaagatagagtgtattcg
ccttccaaacatgtaacgaatcaagagcaactatctttatctgcgcgcagccttatgttt
gtacgtaacgtaggtcatttaatgacaaacgacgcgatgctattcgatggtgagccagta
ccagaaggtattatggacggtttagtgacttcgcttatcgccaagcatgacttactgaat
aacagtccattccaaaactctcgtcatggcagcatttatattgttaaacccaaaatgcat
ggccctgaagaagtggctttttctgatgcgctattcgccaaaatagaaaccgtcatcaat
gtgcctaaaaacacgttgaaaatgggtattatggatgaagaacgccgcaccagcgtgaat
ttagacgcctgcatcaatgctgcgaagtctcgcgttgtatttattaatacaggcttttta
gacagaacaggcgatgaaattcatacgtctatgcttgcaggccctttcgccgaaaaagcg
acccttaagacgatgctgtggattaaagcctatgaaaccgcaaatgtagccgtcggcctt
cgatgtggcctgtcaggtaaggcgcaaattggcaagggcatgtggccaattcccgatgaa
atgcaaaatatgatggatgccaaaattggacatccaaagtctggtgcaaataccgcatgg
gtaccctcacctaccgctgccactttgcatgcgctgcattatcatgatgttaatgtcttc
gacattcagaagggattagatcaagatttctcaggccttaacgatattttgactattcca
ctgctagaaagtagagattcactatcagccgacacgatacagcgggaaatagataataat
gtgcaaggtatcttaggttacgtggttcgttgggtacatcagggagtaggctgctctaaa
gtacctgatattaataatgttgggctgatggaagacagagctacactccgtatttcatcg
cagcacatcgctaactggcttgagcacggcattgtaagtgccgcgcaagttgatgaatcc
cttcgcagaatggcaaagttagttgatgagcaaaatgctggcgacgcagaatatatccct
atgatgcctgatttagatagctcaattggtttcttagccgctagcgatcttatctttaaa
gggaaagaacagccaagtggttataccgagcctttattgcacgcaagacgccgcgaaatg
aaagcgaagttagtctctgtaaaatag

DBGET integrated database retrieval system