KEGG   Alteromonas naphthalenivorans: ambt_04580Help
Entry
ambt_04580        CDS       T01513                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
alt  Alteromonas naphthalenivorans
Pathway
alt03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:alt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ambt_04580
DNA repair and recombination proteins [BR:alt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     ambt_04580
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ambt_04580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim zf-RING_9 HHH_5
Motif
Other DBs
NCBI-ProteinID: AEF02466
UniProt: F5ZB31
Position
1067756..1068355
Genome map
AA seq 199 aa AA seqDB search
MKFSPLLNELIQALTCLPGVGNKSAQRMAFHLLERNRKGAIDLSNVLHNAMEHIHHCQRC
RTFTEDELCEICRHPEREASGLLCIVESPQDVLAIEQTLSYKGQYFVLMGHLSPIDGVGP
EEIGLNELETRFSAGGINEVILATNPTVEGEATAHYIAQLCAAHNVEASRIAHGVPVGGE
LEYIDGNTLTHAFSGRRKL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttagcccgttactgaatgaattaattcaagcgttaacttgccttcctggggta
ggtaataagagtgcccagcgaatggcgtttcatcttttggaacgtaatcgcaaaggggca
atagatttaagtaatgtgctgcacaacgccatggagcatattcaccactgtcagcgctgc
agaacgtttacagaagatgagctgtgcgagatttgccgtcatccagagcgcgaagccagt
ggcttattatgcattgttgaaagcccgcaagatgttttggcaatcgaacaaacgcttagt
tataaaggccagtactttgtattgatggggcatttgtcgcctatcgacggagtagggcct
gaagaaattggcctcaatgaattagaaacccgttttagtgcaggtggcattaacgaagtg
atccttgccaccaaccccacggtggaaggtgaagccactgcgcattacatagcccagctt
tgcgcggcacataatgttgaagcgtctcgtattgctcacggtgtgcccgttggtggcgag
cttgaatatatagatggtaatacccttactcacgccttttctggtcgccgcaaactctaa

DBGET integrated database retrieval system