KEGG   Alteromonas sp. SN2: ambt_04580Help
Entry
ambt_04580        CDS       T01513                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
alt  Alteromonas sp. SN2
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:alt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1067756..1068355
Genome map
AA seq 199 aa AA seqDB search
MKFSPLLNELIQALTCLPGVGNKSAQRMAFHLLERNRKGAIDLSNVLHNAMEHIHHCQRC
RTFTEDELCEICRHPEREASGLLCIVESPQDVLAIEQTLSYKGQYFVLMGHLSPIDGVGP
EEIGLNELETRFSAGGINEVILATNPTVEGEATAHYIAQLCAAHNVEASRIAHGVPVGGE
LEYIDGNTLTHAFSGRRKL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttagcccgttactgaatgaattaattcaagcgttaacttgccttcctggggta
ggtaataagagtgcccagcgaatggcgtttcatcttttggaacgtaatcgcaaaggggca
atagatttaagtaatgtgctgcacaacgccatggagcatattcaccactgtcagcgctgc
agaacgtttacagaagatgagctgtgcgagatttgccgtcatccagagcgcgaagccagt
ggcttattatgcattgttgaaagcccgcaagatgttttggcaatcgaacaaacgcttagt
tataaaggccagtactttgtattgatggggcatttgtcgcctatcgacggagtagggcct
gaagaaattggcctcaatgaattagaaacccgttttagtgcaggtggcattaacgaagtg
atccttgccaccaaccccacggtggaaggtgaagccactgcgcattacatagcccagctt
tgcgcggcacataatgttgaagcgtctcgtattgctcacggtgtgcccgttggtggcgag
cttgaatatatagatggtaatacccttactcacgccttttctggtcgccgcaaactctaa

DBGET integrated database retrieval system