KEGG   Alteromonas sp. SN2: ambt_05180Help
Entry
ambt_05180        CDS       T01513                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
alt  Alteromonas sp. SN2
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ambt_05180
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ambt_05180
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ambt_05180
Enzymes [BR:alt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ambt_05180
Exosome [BR:alt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ambt_05180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1192861..1194444)
Genome map
AA seq 527 aa AA seqDB search
MNRTWKTKLSALALVASSGLQAAVLPEHQTDNAWYSDAQSKLTEKLVTNNQFKAKNVILF
VGDGMGVSTLTSARIHKGQLEGGLGEEGYLAFETFPHTALVKTYNVDAQTPDSAGTMTAM
MSGLKTDVGVIGVDEDIERGECATVAGNEVITALELAEIKGLATGIISTARITHATPAAT
YAKSADRNWEDISDMPEEAAAAGCIDIADQLVNFESFLEGRYTGVDVDGIEVVMGGGRRH
FLPNDASFNSADAVSEVEGDRTDDRDLTEEWQQMYENGVYVVDQAGFDTLDTESTERVFA
LFNESHMQYEADRANDVAGEPSIAEMTEAAVNILDNNDTGFFLMVESGRIDHAHHAGNAA
GALTDTLAFEAAVMAAYENTDPSETLILVTADHGHVFTIAGYPKRGNPILGKVVNVGAEE
PATASDGTPYTTLGYTNGLGFRDLGTETDSDEGYNYDNAAGRVDLTNVDTTTAGYHQEAL
IPLGSETHSGEDIALHATGPGSQLAQGVIEQNVVFHLINQALGLINE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtacttggaaaacgaagcttagtgctcttgcactggttgcttcatctggtttg
caagcagctgttttacccgaacaccaaacagataacgcatggtattcagatgcgcaaagc
aaacttactgaaaaactagtgacaaacaaccagttcaaagccaaaaacgtgattttgttt
gtaggcgacggaatgggggtttctacgctaacttctgcgcgcatccacaaagggcagctt
gaaggcgggttgggcgaagaaggttacttggcatttgaaaccttccctcacacagcgttg
gttaaaacctacaatgttgatgcacaaactccagattcagcaggtacgatgacagcgatg
atgtcaggcctaaaaacggatgtgggtgttattggcgttgacgaagatattgaacgcggt
gaatgcgctaccgttgctggcaatgaagttattactgcacttgaacttgctgaaattaaa
ggtttagcgactggtattatctctactgcacgtattacacacgctacgcctgcagccact
tacgctaaatcagctgaccgtaactgggaagatatttcagatatgccagaagaggctgct
gcggcaggctgtattgatattgccgatcagttagtcaattttgaaagcttccttgaaggc
cggtacacaggtgttgatgtagacggtattgaagtggtaatggggggcggccgtcgtcac
ttcttacctaatgacgcgtcttttaatagcgctgatgcggttagcgaagtagaaggcgat
cgtacagacgatcgtgaccttaccgaggaatggcagcagatgtatgaaaatggtgtctat
gttgttgaccaagcaggcttcgacactttagatactgaatcgactgaacgggtttttgct
ttgttcaacgagtcacacatgcaatacgaagcagaccgcgccaatgacgtagcgggcgag
ccatctattgctgaaatgaccgaagctgcggtaaacatcttagataacaacgacactggt
ttcttcttaatggttgagtcaggccgaattgatcatgcccaccacgctggtaatgcagcc
ggtgcacttacagacactttggcgtttgaagccgctgttatggccgcttatgaaaacaca
gatccatctgaaacacttatcttagttacagctgatcacggccacgtatttactattgca
ggctacccaaaacgcggtaatcccattttaggtaaagtggttaatgttggagcagaagaa
cctgctacagcgtctgacggcacgccatataccacattaggttacaccaacggcttaggt
tttcgtgaccttggaacagaaaccgattctgatgaaggttacaactacgataatgcggca
ggtcgtgtggacttaaccaatgtagataccactaccgccggttatcaccaagaagcactt
attccacttggatctgaaacacactctggtgaagatatagcattacacgcaactggacca
ggaagtcaattagcacaaggtgtgatagaacaaaatgttgttttccacctaatcaaccaa
gcccttggcctgataaacgaataa

DBGET integrated database retrieval system