KEGG   Alteromonas sp. SN2: ambt_05485Help
Entry
ambt_05485        CDS       T01513                                 

Definition
hypothetical protein
Organism
alt  Alteromonas sp. SN2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1257019..1258458)
Genome map
AA seq 479 aa AA seqDB search
MPHKVSEHSAEIWTGTLFPYLRKPALSRIIVYINNTEISRVDITLAQWQRPFRRVSKRFY
VLLTLDNLLPNQEYRVVFFQQLEDDALDYAGDWLLLKTAYFSTLPLALPTSETNAFTVSL
SSCFYEHKDYGQTAQAFKTLYANNNKVFKPDIKFMVGDQVYLDIGADSLSPLTNEVRLRI
ADDYAKHWQALGSMLSRGGTWMLPDDHEYWNDYPFYDGIVPTLYMLRIPKIRAAWKGASE
DGVKRIQQTKALIETFTIGNDLSFCIADLRSSRSKTQFINKAGFAELIEWITTLTTPGVL
VIPQVLVTQENKLERNLLSFKKQYTALLNALATASHDIVVLSGDVHFGRICSVDIGTKGV
KLIEVVASPTSNLTGVNSVASSKPSYFPEKFPDPKAKLDVNWPESNVNYYDEPYQLTTTK
GRWFSSYWRDRTNEHMMTIGFNKIDGKVNMTVQAWLIRKTDADGKPKPQFKAPFTIALN
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
gtgcctcataaggtttcagaacacagtgctgaaatttggacgggcactttattcccttat
ttaagaaaaccggcgcttagccgtataattgtatatataaataataccgagataagccga
gtagatattacgctagctcaatggcaacgcccttttcgccgcgtcagcaagcgattttat
gtgcttttaacgctggataacttgctgccaaatcaagaatacagagtggttttttttcaa
caattagaggacgatgctctggattacgcaggcgattggcttctgttaaaaacggcttat
ttcagtaccttgcctttagcacttcccaccagcgagacaaacgcttttacggtttcttta
agcagctgtttctatgagcacaaagactatggccaaactgcccaagccttcaaaacgctg
tacgcaaacaataataaggtgtttaaacccgacataaagttcatggtaggcgaccaagtt
tacttagatattggcgctgactctctttccccgctaaccaacgaagtaagacttagaatt
gccgatgactacgcaaaacactggcaagcactaggaagcatgctttctcgtggcggcacc
tggatgctaccggacgaccacgaatattggaatgattacccgttttatgatggcatagta
cctaccctatacatgttgagaattcctaaaattcgcgccgcgtggaaaggcgcatctgaa
gatggtgttaagcgcattcagcaaacgaaagcgctgattgaaaccttcaccattggtaac
gatttatctttttgcatcgccgatttacgctcttcacggtcaaaaacccagtttatcaac
aaagcgggatttgctgagctcattgaatggataaccacacttaccacacctggggtattg
gtcattccgcaggttttagtcacccaagaaaataagctagaacgcaacttactaagcttt
aaaaaacaatacaccgcgcttttaaatgcccttgctactgccagccatgacattgttgta
ctgtcgggcgacgtgcactttggccgtatatgctcagtagatattggtacaaagggagtt
aaactcattgaagtcgtggcatcaccaacatcgaaccttactggcgtgaactctgttgcc
tcatctaagccaagctatttccccgagaaatttcccgacccgaaagccaagctggatgtg
aattggccagaaagtaacgttaactattatgatgagccataccagctcaccacaacgaaa
ggcagatggttttcttcatactggcgagacagaacgaatgaacacatgatgacaattggt
tttaacaaaatagacggcaaagtgaacatgactgttcaagcgtggttaattaggaaaacg
gatgcagatggaaaaccaaaaccccaatttaaagcgccttttacgattgccttaaactga

DBGET integrated database retrieval system