KEGG   Alteromonas sp. SN2: ambt_05850Help
Entry
ambt_05850        CDS       T01513                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
alt  Alteromonas sp. SN2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ambt_05850 (malQ)
Enzymes [BR:alt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     ambt_05850 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1342296..1344491
Genome map
AA seq 731 aa AA seqDB search
MTQDLLQQLVEMRGIETQYVDAWGKPATIAESSKAKLLNVLGYDTASEEKIQSQIIDDIS
SVWLSPLNPVQVVRSDEAIVIVVRLPIELVNDEHVITVHCENGKIEKHTFTPVDQEMTTM
AHIDEVEFHEYVVSLPLNLPLGYHTMALSADDDQFAESRIIVAPKACYTPDPIAAGKKIW
GLSVQLYCVRSGKNWGIGDFTDLATLIEKAAGVGADFIGLNPIHALYPANPDACSPYGPS
SRRWLNYLYIDASAIEGFDDDSVQAVVNAEEFQKTLSHARETEHVDYEAVAHIKLAALKA
VFDVYDARHLRKNTKQNKAFKAFVTEGGESLDMLAVYDALQSHLKAKGKDCWGWPVFPEE
YKDYHNPAVAKFKKANAGNVKFYLFLQWIAAQQLEAASSKATECGMTIGLYRDLAVGVSE
GSAEIWGNKDLYCVNASVGAPPDILGPLGQNWGLPPMDPRKLYEQAYQPIIDLFSANMAS
SGSLRIDHVMALLRLWWVVKGDDAKEGGYVYYPVDDLLGILALESHRNQSLVIGEDLGTV
PEEIRSKLADNGVYSYRVFFFEQAEDGGFFSPSHYPVQSMSTLTTHDMPTLIGYWHCLDL
ALGKDIGLYPTDDILQTLYADRHANKQSILDSLHGHHSIPDNVGSDVNTTGMTGELSKGM
QVHMAGGSSALLSLQLEDWLQMDKPVNIPGTFNEYPNWRRKLTKNVEAIFETHDITELAA
QLTQARKQASA
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagatcttctgcaacaactggttgaaatgcgtggaatagagactcaatacgtc
gacgcatggggcaaaccagcaaccatcgcagagtcaagtaaagccaaattacttaacgtg
ctgggttatgacaccgccagtgaagaaaagattcaatcgcaaattatagacgacattagc
tcagtttggttatctcctctgaaccctgttcaagtggttcgtagcgatgaggctattgtt
atcgttgtgcgcttacctatagagcttgtaaacgatgaacatgtcattacagttcactgt
gaaaacggaaaaattgaaaagcatacgtttacaccggtagaccaagaaatgacgaccatg
gcgcacatcgatgaggtggagttccatgaatacgtggtgtctttgccacttaacttaccg
ctgggttatcacaccatggcgttaagtgctgacgatgatcaatttgcagagtcacgtatt
attgttgcaccaaaagcctgctataccccagaccctattgccgcgggtaaaaagatttgg
ggtttaagcgtgcaactttattgtgtgcgcagtggaaaaaactggggaataggggatttc
accgaccttgcaacgctaattgagaaagcggcaggtgtaggggctgattttatcgggctt
aatcctattcatgcactttacccagctaatccagatgcgtgttctccttatggtcctagt
tctcgccgctggctaaactacttgtacattgatgcttctgctattgaaggctttgatgat
gacagtgttcaagccgtggtgaatgcagaagaattccaaaaaacgttgagccatgcccgt
gaaacagaacatgtagattatgaggctgtcgcgcatatcaaactggcagcgttgaaagca
gtgtttgatgtctacgatgctcgccatcttcgtaaaaacaccaagcaaaataaagcattt
aaagcgtttgttaccgaaggtggtgaaagcctagatatgctggcggtatacgatgcgctt
cagtcacatttgaaagcgaaaggaaaagactgctggggctggcctgtatttcctgaagaa
tacaaagattaccataaccctgcggttgcgaaatttaaaaaggcgaatgctggtaatgtg
aagttctacctatttttacaatggatagcagcgcaacagttagaagcggcaagcagcaaa
gccaccgagtgcggtatgaccattggtttatatcgagaccttgcggtaggggtaagtgaa
ggtagtgctgaaatttggggtaacaaagatttatattgcgttaacgctagcgtaggtgca
ccacctgatattttagggcctttggggcaaaactgggggcttcctcctatggatcctcgt
aagctctacgagcaggcttaccaaccaatcatcgacttattttcagccaatatggcgtct
tcaggctctcttcgtatagatcacgtaatggcattgctacgtttgtggtgggtagtgaaa
ggtgatgatgcgaaagagggcggttatgtctattacccggtagatgatttattgggtatt
ttggcccttgaaagtcatcgtaaccaaagcttagtgattggtgaagatttaggcaccgtg
cctgaagagattcgcagtaagttggcagacaatggtgtgtattcctaccgtgttttcttc
tttgagcaagcagaagatggcggtttcttctcgccaagccattaccctgtgcagtctatg
tctacacttactacacacgacatgcctacgcttataggttactggcattgtcttgacctg
gcgctcggcaaagatattggtctttatccaacagacgatattttacaaaccttgtatgcc
gatcgccatgcaaacaaacagtcaatattagattcattacacggtcatcattcaattcct
gacaatgttggaagcgatgtgaatactactggcatgactggcgaacttagcaaagggatg
caagtgcatatggctggtggctcaagtgctttattaagcttgcagctagaagactggtta
caaatggacaagcccgtaaatattccaggtactttcaatgagtaccctaactggcgtaga
aagctgaccaagaatgttgaggctattttcgagactcatgatataacagagttggcagct
caattaacgcaagcacgtaaacaagcgagtgcttaa

DBGET integrated database retrieval system