KEGG   Alteromonas sp. SN2: ambt_06065Help
Entry
ambt_06065        CDS       T01513                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
alt  Alteromonas sp. SN2
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:alt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ambt_06065
Enzymes [BR:alt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ambt_06065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1394075..1396234
Genome map
AA seq 719 aa AA seqDB search
MINSHEYLEQLFGIEAIDRFVALEFAHCESLTDAEQVIWLHLLVTLSFMQRSGHSCLLLT
EVAGARLFVEPLLESEAESEAELEAKLETDSEQEQERELEIDPDSRPWIESEPQSAQVLY
VQPEPTTSDSVTSSRKLGYKFPGLTEMISVIKKALGSEKDDKNNKISPLFVYQSGKLYSR
RYYNFEQEIAASIANRTHITALSEDGLSRVKALWPAMFPTNTIDEQDWQQVAVAKSLVQQ
FSVINGGPGTGKTYTVLRLLLALQACNQNERIVLAAPTGKAQQRMTESIVSNLETLRGKV
DDKLLNSVPTDAVTLHRLLGLREHTIATRYNQHNPLMLDVLIVDEASMVDLALMARIIRA
LPPRARLYFIGDADQLPAVELGNVLEQLVHDSDEAEFAEMGISENNLGAVTSELRQHIAT
LCPHLPLLPLNENAKTWVHTLQAPQRFKGQVAEVATAIQAGKSKQALDAMHSDAATEKLL
TENASSQKPKNLSDKNRWLQDGVFIQPESKFTISALKKLAQESYEPVFQAQSAKEALSLL
NRVRWLTPIRKGDMGVEGLNALVFDAIKHNIKRREGFFYQGQPIMIVKNNHPQRLSNGEV
GIIWPDFNGKLLAWFETQDGNLRSISLSRVPAFETVFAMTIHKSQGSEFKYVVLLLPKPE
SEKAAGLFHRGLVYTGLTRAKEGCLIIANTTTFSAMVERRDKRFSGLSEAIKMCVLEGE
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgataaatagtcacgagtacttagaacaacttttcggcattgaagctatcgatcgtttt
gtggcactggagtttgcgcattgcgaaagcctaaccgacgctgaacaggttatttggtta
cacctgttggtaacgttgtcatttatgcagcgcagcggtcatagttgcttgttactcact
gaagtcgcgggagctcggttgtttgttgagccccttctcgaatcagaagccgaatcagaa
gccgaattagaagccaaattagaaactgattccgaacaggaacaagaacgtgaattagaa
atcgaccctgattcacgaccttggatcgaatctgagcctcaatctgctcaggtattgtat
gtacaacctgaacctacaacatcagattcagttacgtcatctcgtaaattaggctacaaa
tttcctggccttaccgaaatgatcagtgtaattaaaaaggcactgggcagtgaaaaggat
gacaaaaataacaagatatccccgctatttgtgtatcaatcaggcaaattgtatagccgg
cgctactataactttgaacaagagatagccgccagtatcgctaatcgaactcatatcaca
gcgctaagtgaagacgggctatcacgggttaaagccttgtggccagcaatgtttccaacc
aacaccattgatgagcaagattggcaacaagttgcggtggccaaaagtttagtgcaacaa
tttagtgttattaacggtggccctggcacagggaaaacctacaccgtactcaggctgtta
ttagcgcttcaagcgtgtaaccagaatgaacgcatagtactagccgccccaacaggtaaa
gcgcagcagcgcatgaccgagtctattgtgagtaatttggaaaccttacggggtaaggtg
gatgacaaattattaaatagtgtacctactgatgctgtcacattacataggttgttaggt
ctacgtgaacacaccatcgccacacgctataatcagcacaacccgcttatgcttgatgtg
cttatagtggatgaagcgtccatggtagatttggcactcatggctagaattattcgcgct
ctaccgcctcgtgcgcgtttgtattttattggtgatgccgatcaactgcctgctgtagag
ttggggaatgtacttgagcaacttgtgcacgatagcgacgaagcagagtttgccgaaatg
ggtatatctgaaaataacctaggcgcagtgactagcgaactacgtcagcacatcgctacc
ctctgtccacatctgcctttacttccgctcaacgaaaatgccaaaacctgggtacatacc
cttcaagcccctcagcgatttaaagggcaggtagctgaagttgccaccgctattcaggca
ggaaaaagcaagcaggcgcttgatgctatgcattcagatgctgccacagaaaagctactc
acagaaaacgcttccagccaaaagcctaaaaacctaagcgacaaaaatcgctggctacaa
gatggtgtatttatacaacctgaaagtaagttcacaatcagcgcgttaaaaaagttagca
caagaaagttacgaacctgtgtttcaagcgcaaagcgcgaaagaagcccttagtttgctc
aatcgcgtgcgatggttgaccccgatacgaaaaggcgacatgggtgtagaaggattaaat
gcattggtgttcgatgcgattaaacacaatatcaaacgccgcgaaggttttttctaccaa
ggccagcccattatgattgtgaaaaacaatcatccacagcgcttatcaaatggtgaggtg
ggtattatctggcctgattttaatggaaagctattggcttggtttgaaactcaagacggc
aacctacgttcaatttcgttatctcgggttcctgcgtttgaaacggtatttgcaatgaca
atacataaatcgcaaggctcagaatttaaatacgtggtgttattactgcctaaaccggaa
agtgaaaaagccgcagggttgtttcatcggggcctagtgtacaccggcctaacgcgggcg
aaagaaggatgtttgattatcgcgaacaccaccacatttagcgctatggtagaacggcga
gataagcgtttttcaggtttatcagaagcgattaagatgtgcgttttagaaggtgaataa

DBGET integrated database retrieval system