KEGG   Alteromonas sp. SN2: ambt_07560Help
Entry
ambt_07560        CDS       T01513                                 

Definition
putative succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with sdhC
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
alt  Alteromonas sp. SN2
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ambt_07560
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ambt_07560
   00650 Butanoate metabolism
    ambt_07560
  Energy metabolism
   00190 Oxidative phosphorylation
    ambt_07560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1695252..1695599
Genome map
AA seq 115 aa AA seqDB search
MLGNQASLKRNGIQDYVSLRTTAAIIFAYTVFMAWFFISTDNITFIAWRGLFSGLAMKVF
TLAALIAIMIHVRIGLWQVLTDYVKASGLRAIIQYVLNIIAFGYVAVGLFVLWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgctaggcaaccaagcaagcttaaagcgtaatggtattcaagattacgtttcactacgt
actaccgctgcaattatttttgcttatacggtattcatggcgtggttttttatatccact
gataatattactttcattgcgtggcgcggattattttctgggctagcgatgaaggtgttc
acattggcagcacttatcgccatcatgatccacgttcgtattggcctttggcaagtactt
accgattatgtgaaggcgtctggtttgcgtgcaatcattcagtatgttctaaacatcatt
gcttttggttacgtcgctgttggtctgtttgtattgtggggagtgtaa

DBGET integrated database retrieval system