KEGG   Alteromonas naphthalenivorans: ambt_07580Help
Entry
ambt_07580        CDS       T01513                                 

Definition
(GenBank) dihydrolipoyltranssuccinate transferase, component of the 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
alt  Alteromonas naphthalenivorans
Pathway
alt00020  Citrate cycle (TCA cycle)
alt00310  Lysine degradation
alt01100  Metabolic pathways
alt01110  Biosynthesis of secondary metabolites
alt01120  Microbial metabolism in diverse environments
alt01130  Biosynthesis of antibiotics
alt01200  Carbon metabolism
Module
alt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
alt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ambt_07580
  Amino acid metabolism
   00310 Lysine degradation
    ambt_07580
Enzymes [BR:alt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ambt_07580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AEF03044
UniProt: F5Z7K1
Position
1701101..1702588
Genome map
AA seq 495 aa AA seqDB search
MTIEIKVPVLPESVADATIATWHVKAGDAVKRDQNLVDIETDKVVLEVVAPADGTIGELL
NEEGATVLGEQVIAKLEEGGAAPAKSEAKAESKKEAAPAASGKTSEVKVPVLPESVADAT
IATWHVAVGEVVSRDQNLVDIETDKVVLEVVAPADGSLSEIVAEEGATVTAEEVIAKFVE
GATSGAAASESSEAASDDSDDSSDALSPSVRRLLAEKGVDAAKVKGTGKNGRITKEDVEK
HLKGGSAPAASAPSAAADLPTGNRTEKRVPMTRLRKTIATRLLEAKNSTAMLTTFNEVNM
KPIMELRKQYQESFEKRHGIRLGFMSFYVKAVTEALKRFPDVNASIDGDDIVYHNYFDIS
IAVSTPRGLVTPILKDTDTLGMAGVEKGIKELAIKGRDGKLSMADLQGGNFTITNGGVFG
SLMSTPIINPPQSAILGMHKIQDRPMAVNGKVEILPMMYLALSYDHRIVDGKESVGFLVT
IKEMLEDPTRLLLDV
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgagataaaagttccggtcctaccagagtcagttgccgatgccaccattgca
acttggcacgtaaaggccggcgacgcggtaaaacgtgaccagaacctggttgacattgaa
actgataaagttgtgctggaagtcgtagcaccagccgacggaactatcggtgagcttctt
aatgaagagggtgcaacggtactaggcgagcaagttattgctaaattagaagagggtggc
gctgcgccagctaaatctgaagcgaaagctgaatctaaaaaagaagcagcacctgcagct
agcggtaaaacgtcagaagttaaagtacctgtattaccagagtcggtagctgatgcaacc
atcgccacatggcatgttgcagtaggcgaagtggtaagccgtgaccaaaacttggttgat
attgaaactgataaagttgttctagaagtggtagcgcctgctgatggctcactatcagaa
attgttgccgaagaaggcgcaacagtgacagctgaagaagtgattgctaaatttgttgaa
ggcgcaacgtcaggtgcagcagcatctgagtcgtctgaagctgcatctgatgattcagat
gacagcagcgatgcacttagtccttcagtacgccgtttattggcagaaaaaggcgtagac
gcagcaaaagttaaaggtacgggtaaaaatggccgtatcactaaagaagacgtagaaaaa
caccttaaaggtggcagtgcaccagcggcttcagcgccatctgctgcagctgatttacct
actggtaatcgcacagaaaaacgtgttcctatgacacgtcttcgtaaaacgattgcaact
cgtttacttgaagctaaaaactctactgctatgctaactacgtttaacgaagttaacatg
aagccaattatggaacttcgtaagcagtatcaagagagctttgagaaacgtcacggtatt
cgtttaggtttcatgtctttctacgtgaaagcggtaactgaagcacttaaacgtttccca
gatgttaatgcatcgattgacggtgatgacattgtttatcacaactacttcgatatctct
atcgcggtatcaacacctcgcggtctagttacgcctatcttaaaagatacggatacacta
ggtatggctggtgttgagaaaggaattaaagaattggcaattaaaggccgtgatggcaaa
ttgtcgatggcagaccttcaaggcggtaactttactatcactaacggtggtgtgtttggt
tcattgatgtctacgcctatcattaacccgccacagagcgctattttgggtatgcataaa
atccaagatcgtccaatggctgttaacggtaaggtggaaattctgccaatgatgtaccta
gccctgtcttatgaccatcgtattgttgatggtaaagagtcagtaggcttcttggtaaca
attaaagagatgcttgaagatccaacacgccttctattagacgtgtaa

DBGET integrated database retrieval system