KEGG   Alteromonas sp. SN2: ambt_07825Help
Entry
ambt_07825        CDS       T01513                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
alt  Alteromonas sp. SN2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ambt_07825
   01230 Biosynthesis of amino acids
    ambt_07825
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ambt_07825
   00030 Pentose phosphate pathway
    ambt_07825
   00051 Fructose and mannose metabolism
    ambt_07825
   00052 Galactose metabolism
    ambt_07825
  Energy metabolism
   00680 Methane metabolism
    ambt_07825
Enzymes [BR:alt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ambt_07825
Protein phosphatases and associated proteins [BR:alt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ambt_07825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1764394..1765389)
Genome map
AA seq 331 aa AA seqDB search
MSKRVAVLTSGGDAPGMNACIRAIVIACERHGFTLFGYQHGYNGLLEQEYEILALQATHN
LIQQGGTVLHSARCEPFKTDEGAKTAATNLTELEIDTLIVIGGDGSFRGADHLADFWHGQ
IIGIPGTIDNDVAGTDATIGYYTAIDTVVSSIDKVRDTADAFERIFIVEVMGRHAGFLAL
NSALASAADYVILPETFQHCDAELDKITEQIEKRRQLKGAISFIIVVAENVWPGGLNDLA
DKLVSKTQSEVRPVTLGHVQRGGSPVSQDRLLATKLGTYAVSLVGSDTNGIMVGELNGTP
SEIALTETWEKDKPLNPSSMETMLTIMNERY
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacgcgttgcagtgctaacatcaggtggtgatgcaccaggaatgaatgcttgt
attcgagctattgttatagcctgtgaaaggcacggatttacactatttggttatcagcat
gggtataatggcttacttgagcaagagtacgaaatacttgcgcttcaagcaacgcacaac
ctcattcagcaagggggcaccgtgctgcacagcgcccgttgtgaacctttcaaaaccgac
gaaggtgcgaaaactgctgccacaaacctaacagaactagagattgataccctaattgtg
attggcggcgatgggtcttttagaggcgccgatcacttagctgatttctggcacggtcaa
atcattggtattcccggcactatagataatgatgtggctggcaccgatgctaccataggt
tattacaccgctatcgataccgttgtttcatcaatcgataaagtgagggacaccgcagac
gcttttgaacgtattttcattgtagaagtgatgggcagacatgccggttttcttgcgcta
aattccgccctcgcctcggcggccgattacgttattttgccagaaacctttcaacattgt
gacgcagaattggataaaattacggagcaaattgagaagagaaggcaactcaaaggcgcg
attagttttatcatagtggtagctgaaaatgtgtggcctggtggacttaacgatttggcc
gacaaactggtatcaaaaacccagtctgaagttcgacctgtaacgctagggcatgttcag
cgtggtggttcaccggtgagtcaagaccggttgcttgccactaagttaggcacctatgcg
gtaagtttagtgggcagtgacaccaacggtattatggtaggtgaacttaatggtacgccg
agtgaaattgccttaacggaaacatgggagaaggataaacccctaaacccttccagtatg
gaaaccatgctcaccatcatgaatgagcgctattaa

DBGET integrated database retrieval system