KEGG   Alteromonas sp. SN2: ambt_08965Help
Entry
ambt_08965        CDS       T01513                                 

Definition
putative sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
alt  Alteromonas sp. SN2
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ambt_08965
Enzymes [BR:alt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     ambt_08965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2006428..2008182
Genome map
AA seq 584 aa AA seqDB search
MTWQVLHDKVKHHLEYIYADVPLEHSLESLTMSLMETMGIKPDEDVSLPQSHSNYWDEDD
IIMITYGDSVIDGDERPLVTLNRFLNRYSKNTINNVHILPFFPYSSDDGFSVIDYSSVNE
ALGSWDDIEAIAKDYGLMTDLVINHCSARSVWFDNFIKGEGPGSDFFFTGDPADDLSIVT
RPRVSPLLRETETKDGTKHVWCTFSHDQVDFDFRNPKVLLTFIDIIRLYIDKGAKIFRLD
AVAFLWKIVGTNCINLPQTHEVIRLIRTLIEHVDPSIIIITETNIPNRENLTYFGNANEA
HAIYNFSLPPLLVNTLVTGNCKYLKSWMMSMPPAQNGTAYFNFIASHDGIGLRPAEGLLD
DEEISELVHTMQNFGGKISWRASDHGQQKPYEINITLFDALQGTTKGPDKWQIDRFICAH
AIMLGMEGIPGIYIHSLLGTSNDYEKVANTGQNRSINRRRWDFKELEALLDSPYSQHHKV
LTRLSQLIRIRKAQPAFHPNATQFTLQLNESIFGYWRQSLDRKQSIFCISNVSDEEQTIL
LSDINLIGTDNWIDLVTRQQIALSDAFLQLKPYQVLWISNQDFE
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgacatggcaagtactccatgacaaagtgaagcaccatctagaatatatctatgctgac
gtgccccttgagcattcattagaaagcttaaccatgtcgttgatggagacaatgggtatt
aagcctgatgaagatgtttcacttcctcaatcccattctaattattgggacgaggatgac
atcatcatgatcacctatggcgatagtgttattgatggcgacgaacgaccgctcgttacc
ctcaatcgctttttaaatcgctatagtaagaacactatcaataatgtgcacattctgcct
ttctttccatacagttcagacgatggcttttcggttatcgactattcaagtgtgaatgaa
gccttgggcagctgggacgatattgaagccattgcaaaagactacgggttaatgactgat
cttgtgattaaccactgttctgcacgcagtgtatggttcgataacttcatcaaaggtgaa
ggtccaggttcagatttcttctttactggggatcccgcggacgatttgtctatcgttacc
cgccctagggtttcgcctttattgcgtgaaacagaaaccaaagatggcactaaacatgtt
tggtgtactttcagtcatgaccaagtcgattttgatttcaggaaccctaaggtacttctt
acgttcattgatatcattcgtttgtatatcgacaagggcgcaaaaatattccgcttagac
gcggtggcgtttttgtggaaaattgttggcactaactgcattaaccttcctcaaactcat
gaggttattaggttaattcgcacgctgattgaacatgtcgacccgtctattattatcatt
actgagaccaatatccccaacagggaaaatttgacctatttcggtaatgccaatgaagcc
catgctatttataacttttcattgccaccactattggtcaacaccttggtaacgggtaat
tgtaagtacttaaagagttggatgatgagcatgccacctgcgcaaaacggtacggcatac
tttaacttcattgcatcgcacgatggtattggccttcgccctgccgaagggttgctagac
gatgaagaaatttcagaacttgtgcataccatgcaaaactttggtggcaaaatttcgtgg
cgcgcgtctgatcatgggcaacaaaagccttatgaaataaacattacgttatttgatgcg
ttacagggaacaacaaaaggcccggataaatggcagatagaccgctttatctgtgcgcac
gccattatgctgggaatggaaggtattccaggcatttatattcatagtttattaggtacg
tctaacgactatgaaaaagtggctaatacaggtcaaaaccgttcaatcaaccgtagacgt
tgggatttcaaagagctagaagccttgcttgattcgccctattctcagcatcacaaagta
ttgacgcgattgtctcagttaattcgaattcgtaaagctcagccagcattccacccgaat
gctacgcaattcacgttgcagcttaacgaaagtattttcggttattggcgacaaagctta
gacagaaagcaaagtatcttctgcattagtaatgtgtcggatgaagagcaaactattcta
ctgtcagatatcaatttgattggtactgataactggatagatcttgtgactcgccagcaa
attgccttgtcggatgcctttttgcaattgaagccctaccaggtactttggataagcaac
caagactttgagtaa

DBGET integrated database retrieval system