KEGG   Alteromonas sp. SN2: ambt_09475Help
Entry
ambt_09475        CDS       T01513                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
alt  Alteromonas sp. SN2
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ambt_09475
   01230 Biosynthesis of amino acids
    ambt_09475
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ambt_09475
   00051 Fructose and mannose metabolism
    ambt_09475
   00562 Inositol phosphate metabolism
    ambt_09475
Enzymes [BR:alt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ambt_09475
Exosome [BR:alt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ambt_09475
  Exosomal proteins of bladder cancer cells
   ambt_09475
  Exosomal proteins of melanoma cells
   ambt_09475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2123618..2124364)
Genome map
AA seq 248 aa AA seqDB search
MNNNKRKPLVAGNWKMNGNRSLVTAFNDAFENNAVDNVDVVICPPALYLSAFSTQAFALG
GQDVSHLDNGAHTGDLSADMLCELGCKYAIVGHSERRDDHGESNSLVAEKAKKSIASGLT
PIICVGESLDIRESGQVESFIGEQLDALVNGLTVEELSKSVLAYEPVWAIGTGKTASPEQ
AQDVHEFIRGYFAKVDAELAQGLRILYGGSVKADNAKTLFAQQDVDGGLIGGASLKTEDF
ISICQAAN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgaataacaataaaagaaagccgctggtagcgggcaattggaaaatgaacggtaatcgt
tctctcgtcactgcgttcaacgatgcatttgagaataatgcggttgataatgttgatgta
gttatttgtcctcctgctttatatctttcagcattttctacccaagcttttgcgctgggt
ggacaagatgtgagtcatcttgataatggcgctcacacgggtgacctttctgctgacatg
ctgtgtgaacttggttgtaagtacgccatagtagggcactcagagagaagagacgaccac
ggtgaaagcaatagcttagtggccgaaaaagcaaagaaatcaattgcgagtggattaacc
ccaattatttgtgtgggtgagtcgcttgatattagagaaagtggtcaggttgagtctttc
attggcgaacaacttgatgcattagttaacggtttaaccgttgaagagctttctaaatcg
gtacttgcttacgagcctgtttgggccataggtactggaaagactgcttcacctgaacaa
gcgcaagatgtacatgaatttattcgtggatactttgcaaaagtagacgcagagcttgct
caagggttacgaattttatatggcggcagtgttaaagcagataatgctaaaacattgttt
gcacaacaagacgtagatggtggcctcattggtggcgccagcttaaagacagaagatttt
atttcaatttgccaagcggcaaactga

DBGET integrated database retrieval system