KEGG   Alteromonas sp. SN2: ambt_10425Help
Entry
ambt_10425        CDS       T01513                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
alt  Alteromonas sp. SN2
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:alt00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:alt00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2334714..2335784)
Genome map
AA seq 356 aa AA seqDB search
MGPLMLDCQTERLLPEEREKLAHPVVGGVILFSRNYHDREQLTQLVKEIRESAKKPLLIA
VDHEGGRVQRFREGFTKLPAMGKLSGLVQAKAAGKDIDWADLLEIEPEAEETIVNDATLE
LAKACGTIMAHELKQIDIDFSFAPVLDINGVSKVIGDRAFAETAEKVIPLASALIEGLQV
ANMPAIGKHFPGHGSVAPDSHVALPVDERPLEEIKQTDMVVFERLISKQLLDGVMPAHVI
YSQVDSKPAGFSEHWLQKILKQDLGFNGAVFSDDLSMHGASVAGNYVDRAMAALSAGCHM
VLACNNPKGAESILDALPHSTDSFEALTSLYGRKAVVHASAAYKNALKVLSRYGIG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgggcccgttaatgcttgattgtcagacagagcgtttattgcctgaagagagagaaaaa
ttagcacatcctgtggtgggcggcgtcatactatttagccgtaattatcacgatcgcgag
caacttactcagttagtaaaagaaattcgagaaagtgccaaaaagcctttattaatagcg
gtcgatcacgaagggggcagggttcaacgctttcgtgaaggttttaccaagttacctgct
atgggtaagttatccgggttggtacaggcgaaagcggcaggaaaagatatcgactgggca
gatttactggaaatagagccagaagcagaagagacaatagtcaacgatgccacgctagaa
ctagctaaagcctgcggtaccattatggctcatgagctaaaacagatagacatcgatttt
agttttgcccctgtgcttgatattaacggggtatcgaaagtgattggcgacagagccttc
gctgaaaccgcagaaaaggtgatccccttagcctcggcgctaattgaaggtttacaggtt
gccaatatgccagccattggaaagcactttcctgggcatggcagtgtggccccagattct
cacgtggcgttacctgtagacgaaagaccgcttgaagaaattaaacaaactgatatggtt
gtttttgaaagattaatttctaaacagttgctagatggtgtaatgccagcgcacgttatt
tattctcaagttgatagcaagccagccggcttttccgagcactggttacaaaaaatatta
aagcaagacttgggttttaacggtgccgtgttctctgatgacctgtctatgcacggtgcc
agtgttgccggcaattatgtcgatcgtgccatggctgcattatcagcaggttgccatatg
gtattggcatgtaataacccgaaaggggcggaatctattttagatgcgctgccccattca
acagactctttcgaggctttaacctcactttacgggcgcaaagcagttgtgcatgccagt
gcagcttataaaaacgcattaaaggtgttgtcgcgctatggaatcggttaa

DBGET integrated database retrieval system