KEGG   Alteromonas naphthalenivorans: ambt_10425Help
Entry
ambt_10425        CDS       T01513                                 

Definition
(GenBank) beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
alt  Alteromonas naphthalenivorans
Pathway
alt00520  Amino sugar and nucleotide sugar metabolism
alt01100  Metabolic pathways
alt01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ambt_10425
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    ambt_10425
Enzymes [BR:alt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ambt_10425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: AEF03609
UniProt: F5ZBF2
Position
complement(2334714..2335784)
Genome map
AA seq 356 aa AA seqDB search
MGPLMLDCQTERLLPEEREKLAHPVVGGVILFSRNYHDREQLTQLVKEIRESAKKPLLIA
VDHEGGRVQRFREGFTKLPAMGKLSGLVQAKAAGKDIDWADLLEIEPEAEETIVNDATLE
LAKACGTIMAHELKQIDIDFSFAPVLDINGVSKVIGDRAFAETAEKVIPLASALIEGLQV
ANMPAIGKHFPGHGSVAPDSHVALPVDERPLEEIKQTDMVVFERLISKQLLDGVMPAHVI
YSQVDSKPAGFSEHWLQKILKQDLGFNGAVFSDDLSMHGASVAGNYVDRAMAALSAGCHM
VLACNNPKGAESILDALPHSTDSFEALTSLYGRKAVVHASAAYKNALKVLSRYGIG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgggcccgttaatgcttgattgtcagacagagcgtttattgcctgaagagagagaaaaa
ttagcacatcctgtggtgggcggcgtcatactatttagccgtaattatcacgatcgcgag
caacttactcagttagtaaaagaaattcgagaaagtgccaaaaagcctttattaatagcg
gtcgatcacgaagggggcagggttcaacgctttcgtgaaggttttaccaagttacctgct
atgggtaagttatccgggttggtacaggcgaaagcggcaggaaaagatatcgactgggca
gatttactggaaatagagccagaagcagaagagacaatagtcaacgatgccacgctagaa
ctagctaaagcctgcggtaccattatggctcatgagctaaaacagatagacatcgatttt
agttttgcccctgtgcttgatattaacggggtatcgaaagtgattggcgacagagccttc
gctgaaaccgcagaaaaggtgatccccttagcctcggcgctaattgaaggtttacaggtt
gccaatatgccagccattggaaagcactttcctgggcatggcagtgtggccccagattct
cacgtggcgttacctgtagacgaaagaccgcttgaagaaattaaacaaactgatatggtt
gtttttgaaagattaatttctaaacagttgctagatggtgtaatgccagcgcacgttatt
tattctcaagttgatagcaagccagccggcttttccgagcactggttacaaaaaatatta
aagcaagacttgggttttaacggtgccgtgttctctgatgacctgtctatgcacggtgcc
agtgttgccggcaattatgtcgatcgtgccatggctgcattatcagcaggttgccatatg
gtattggcatgtaataacccgaaaggggcggaatctattttagatgcgctgccccattca
acagactctttcgaggctttaacctcactttacgggcgcaaagcagttgtgcatgccagt
gcagcttataaaaacgcattaaaggtgttgtcgcgctatggaatcggttaa

DBGET integrated database retrieval system