KEGG   Alteromonas sp. SN2: ambt_11175Help
Entry
ambt_11175        CDS       T01513                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
alt  Alteromonas sp. SN2
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ambt_11175 (ipk)
Enzymes [BR:alt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     ambt_11175 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2496241..2497161
Genome map
AA seq 306 aa AA seqDB search
MDAALMTNSKVTNLQEIGLDWWPSPAKLNLFLHINGRYPNGYHQLQSLFQMLDYGDKLAF
DINDSGVISMATPLKGVKDEDNLIVRAAKLLAEHAHINKGVNISLEKCLPMGGGIGGGSS
NAATTLVALNQLWGVKLSEDELAELGLELGADVPIFVRGLTAFASGVGEEITPAPQEEKW
YLVANPNVHISTAEVFTAEKLTRNTPIMQWEDYQFEKTRNDCQQLVVNRYPEVANLLQWL
VHYAPSRMTGTGACVFAIFSDDVCAKQVQAKLPAAWHSFVAKGVNRSPLLQKLKKSEHVY
ATSDKK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgctttaatgacaaattctaaagtaacgaacttacaagagataggcctagat
tggtggccttctcctgccaaacttaatctttttctgcatattaatggtcgatacccaaat
ggctatcaccaattgcaaagcttatttcaaatgcttgattacggcgacaagcttgctttt
gatattaatgactcgggtgtaatttctatggcgaccccgctaaaaggggtaaaagatgaa
gataaccttattgttcgtgccgccaaactgctagctgaacatgctcacattaataaaggt
gtaaacatcagtttagaaaaatgcttgcccatgggcggcggtattggcggcggttcatca
aatgcagccaccaccctagtcgcactaaaccagttatggggcgttaaactatcagaagat
gaacttgctgagcttgggcttgaattaggtgcagatgtacctatttttgtacgcggactt
accgctttcgcatcaggggtaggtgaagaaatcacccctgccccgcaagaagaaaaatgg
tatttggtggcgaaccccaatgtgcatattagtactgccgaggtatttacagctgagaaa
ttgaccagaaatacaccaattatgcagtgggaagactaccaatttgaaaaaactcgcaat
gattgtcagcaattagtcgttaatcgctatcccgaagttgcaaatttattacagtggttg
gtacactacgcaccgtcgcgaatgacgggcacaggtgcctgcgtatttgccatcttttct
gacgacgtttgcgccaaacaagttcaggctaaattgcctgctgcttggcatagttttgtt
gcaaaaggtgtgaatcgctcaccgctattacaaaaattaaaaaaatcagagcacgtgtac
gccacatcggacaagaaataa

DBGET integrated database retrieval system