KEGG   Alteromonas sp. SN2: ambt_11555Help
Entry
ambt_11555        CDS       T01513                                 

Definition
putative 3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
alt  Alteromonas sp. SN2
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    ambt_11555
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    ambt_11555
Enzymes [BR:alt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     ambt_11555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2589341..2590108
Genome map
AA seq 255 aa AA seqDB search
MTKRTVFITGGASGIGFGIAQAMSKAGHHVIIADINEQAAQRAANDIIRENGSASAIEVD
VCNAQQVAALPDLLKEQKVNVLINNAGIQHVSRIENFPPEKWQQLINIMLVGPALLTQAF
LPNMREQNFGRIINIGSIHSLVASPYKSAYVAAKHGLLGFAKTIALETGDCDVTINTLCP
AYVKTPLVEKQIASQAKENNLTEEEVINKIMLEPMPKKQFISLDELSDTAAFLMSDSARN
ITGQTMILDGGWTAR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgactaagcgaaccgtatttataactggtggcgctagcggtattggctttggtatagca
caagcgatgtcgaaagcgggacatcatgtcatcattgccgatattaacgaacaagccgca
cagcgtgctgcgaacgatattatacgagaaaacggcagtgccagcgctattgaagttgat
gtttgcaatgcacagcaagtagccgctttacccgacttgctcaaagagcaaaaagtaaat
gtgttgattaacaatgccggtattcagcatgtctcacgcattgaaaacttcccgcctgaa
aaatggcagcaactgattaatattatgctggttggccccgcgcttttaacccaagcgttt
ttacctaacatgcgcgagcaaaactttgggcgaataatcaacatcggttcaattcactca
ctggtggcatccccttataaatcggcttatgtggcagcgaaacatggcctgctggggttt
gctaaaactatcgcccttgaaaccggcgactgtgatgtcaccatcaacactctatgccct
gcctatgtaaaaacaccgttggtcgaaaagcagattgcctctcaggctaaagaaaataac
cttacagaagaggaagtgatcaacaaaataatgcttgagccaatgcctaaaaagcagttt
attagcctagatgagttgtctgacacagcggcatttttaatgtcggatagtgcacgcaat
attaccggccaaaccatgatactggatggcggctggacagcccgataa

DBGET integrated database retrieval system