KEGG   Alteromonas sp. SN2: ambt_11670Help
Entry
ambt_11670        CDS       T01513                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
alt  Alteromonas sp. SN2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ambt_11670
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ambt_11670
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ambt_11670
Enzymes [BR:alt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ambt_11670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2615203..2616012
Genome map
AA seq 269 aa AA seqDB search
MERYAEMFARLDAKNEGAFVPFVMIGDPDLAQSEAIICQLVESGADALELGIPYSDPIAD
GPTIQAASIRAHKSNVTVAKCFELLARVRSKYPQVPIGLLLYSNLVMAQSIDGFYKKASD
AGVDSILVADVPIREAAPFQKAADANGISQILIAPPNATDETMEKIGEYSKGYTYLLGRA
GVTGAETAVEIPAAELIARLTAHKCAPPLLGFGISTPAQVKSAIDAGAAGAISGSATVNL
IAANLDNNDAMLSALGEFVQSMKAATAKG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggaaagatatgcagaaatgtttgcgcgcctagacgcaaaaaatgaaggcgcttttgtt
cctttcgtgatgataggcgaccctgatttagcacaatctgaagcgattatttgccaattg
gttgaaagtggtgctgatgcgctagagcttggtattccttattcagatcccatcgccgat
ggccctactattcaagcggcgagtattcgtgcgcacaaaagcaacgttacagtagctaaa
tgttttgaattattggcgcgcgtacgcagtaagtacccacaagtccctattggtttactt
ctatacagcaacctagtgatggcacagtctatcgatggcttttataaaaaagccagcgat
gcaggggtagattctattttggttgctgatgtgcctattcgtgaagcagcaccattccaa
aaagcggctgatgctaatggaatatcacaaattttgatagctccgccgaatgcgaccgat
gaaaccatggaaaaaattggtgagtattcgaaaggctatacgtacttgttaggtagagct
ggggtaactggcgctgaaactgctgtagaaattcctgccgctgagttgattgcacgacta
acggcacataaatgtgcaccgccactacttggatttggtatttctacgccagcacaagta
aagtcggccattgatgctggtgcagcgggcgctatttcaggttcagctacagtgaacttg
attgcagcaaacttagacaacaacgatgctatgctaagtgcattgggtgagtttgtgcag
tctatgaaagccgccactgctaagggttaa

DBGET integrated database retrieval system