KEGG   Alteromonas sp. SN2: ambt_11725Help
Entry
ambt_11725        CDS       T01513                                 

Definition
lipase/acylhydrolase, GDSL family protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
alt  Alteromonas sp. SN2
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ambt_11725
Enzymes [BR:alt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ambt_11725
   3.1.2  Thioester hydrolases
    3.1.2.-  
     ambt_11725
Lipid biosynthesis proteins [BR:alt01004]
 Fatty acid synthase
  Component type
   ambt_11725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2626092..2626748
Genome map
AA seq 218 aa AA seqDB search
MIYRFRSAVLFTLLLLIPLSALSDQTDTIVPNNSAKLLILGDSLSAAYGLDQQEGWVSLL
QKRWRDENISIDIVNAAVSGETTDGGLARLPRLIEQHTPSHILVELGGNDGLQGHSISKI
RNNLSAIVSIAKSDNTTVFVQDMQIPTNYGKRYTQMFSDTFDTVSEQHEVTKIPFFLEDI
ALQKDLMQRDGIHPNAKAQPMIVEFMFEKLTPLIMNNQ
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgatttatcgttttcgcagcgccgttttgttcacactgcttttattaataccgttatct
gcattatcagatcagaccgataccatcgtccccaataattcagctaaattactgattcta
ggtgacagcctatctgctgcttatgggttagatcaacaagaaggttgggtgagtttgtta
caaaaacgctggcgtgacgagaatatatcgatcgatattgtaaatgctgcggtaagcggt
gagaccactgatggcggtttagctaggcttccgaggttaattgaacaacatacgccaagc
catattttagtagaactcggtggtaatgatggcctgcaagggcacagtatcagtaagatt
aggaacaacttgagcgcaattgttagcatagcaaaatcggacaatacaaccgtttttgtg
caagacatgcagatacccactaattacggtaaacgctatacacaaatgtttagcgacact
tttgataccgtgtcagagcaacatgaagttacaaaaattcctttttttcttgaggacata
gcacttcaaaaagacttgatgcaacgtgatggtattcaccctaacgcaaaagctcagcct
atgattgtcgaatttatgttcgaaaaactgacgcctttgatcatgaataatcaataa

DBGET integrated database retrieval system