KEGG   Alteromonas sp. SN2: ambt_12430Help
Entry
ambt_12430        CDS       T01513                                 

Definition
putative PAP (3,5 adenosine diphosphate) 3 phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
alt  Alteromonas sp. SN2
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ambt_12430
Enzymes [BR:alt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     ambt_12430
Transfer RNA biogenesis [BR:alt03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    ambt_12430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2790931..2791731
Genome map
AA seq 266 aa AA seqDB search
MAQANTMTNTLAQTILRIAKEAGDKIMAIYDKDFAIYEKQDTSPLTEADLAAHNVIVDAL
GKESDLPILSEESADISWDERKQWQSYWLVDPLDGTKEFIKKNGEFTVNIALIEDGKPTM
GVVYAPALNKSYVGIVGEGAWTEVDGEFTAISARKHDGAEVWKIVGSRSHQSPEIQNLLS
QLEGETELVAMGSSLKLCLVAEGEAHLYPRLGPTSEWDTGAAHAVALAAGANVTVLDPND
PLNDNADALTYNQKESVLNPFFLVSA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggctaatacaatgactaatacactggcacaaaccattcttcgcattgctaaa
gaagcaggcgataagataatggcgatttacgataaagatttcgctatttacgaaaaacaa
gatactagcccgctaaccgaagctgacttagcggcgcacaacgtaattgttgatgccctt
ggaaaagaatctgaccttcctattttatcggaagagtcggcagacatttcatgggatgag
cgcaaacaatggcagtcttattggcttgttgatccgcttgacggcacgaaagaattcatt
aaaaagaatggtgaatttacagtgaacatcgcgttaattgaagacggcaaacctaccatg
ggtgtggtgtacgcaccggcacttaacaaaagctatgtaggtattgtgggtgaaggcgca
tggactgaagtagacggcgaatttactgctatttctgcacgcaagcacgatggtgctgaa
gtatggaaaatagtaggtagccgctctcaccaaagccccgaaattcaaaatttactgtct
caactagagggtgaaactgaattagtggccatgggtagttcattaaagttatgcctagtg
gctgaaggtgaagctcacctttatcctcgcttaggcccaacatctgagtgggacacaggc
gccgcccatgctgtagccctagccgcaggtgccaatgtaactgtgctagacccgaacgat
ccgttaaatgacaacgccgacgctcttacttacaaccaaaaagagtctgtgttaaacccc
tttttccttgtgagcgcataa

DBGET integrated database retrieval system