KEGG   Alteromonas sp. SN2: ambt_12465Help
Entry
ambt_12465        CDS       T01513                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
alt  Alteromonas sp. SN2
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ambt_12465 (asnB)
Enzymes [BR:alt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     ambt_12465 (asnB)
Peptidases [BR:alt01002]
 Cysteine Peptidases
  Family C44
   ambt_12465 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2799878..2801551
Genome map
AA seq 557 aa AA seqDB search
MCGIFGILDIKTDVSELRTQALELTKLLRHRGPDWSGIWNNDNTILCHERLAIVDVDTGA
QPLISQNGKQVLAVNGEIYNHKQLADDLAEPYPFKTRSDCEVILPLFQQKGVSFVDELEG
MFSFVLYDEEQDAYLIARDHMGIIPLYTGYDEHGNFYVASEMKALAPICKTISEFPPGHY
LWSKDGQITKYYKRDWMEYDAVKDNTTNLDDLRVAFEKSVKSHMMSDVPYAVLLSGGLDS
SLVSAIAAKYVAKRVEDEDKTEAWWPRLHSFAVGLEGAPDLKAAKKVADMIGTVHHEIHF
TIQEGLDAIRDVIFHLETYDTTTIRAATPMYLMTRKIKAMGIKMVLSGEGADEIFGGYLY
FHKAPNAKEFHEETVRKLDRLHLFDCARANKATSAWGVEARVPFLDKNFIDVAMRLNPQD
KMCLDGKMEKWILRKAFDNGDTLPAEVLWRQKEQFGDGVGYSWIDSIRDFVENEVSDQQF
ASAEFRFPVNTPDTKEGYYYRTIFEGYFPQESAARCVPSGKSIACSTVEALEWDESFKNN
ADPSGRSMKDVHSGASD
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattttcggtatccttgatatcaaaaccgatgtgtctgaactcagaacccaa
gccctcgaattaacaaaattattgcgccaccgtggccctgactggtcgggaatctggaat
aatgacaataccattctttgtcacgaaagattggctattgttgatgtggacaccggcgct
cagccgcttatcagccaaaatggcaaacaagttttagccgtcaatggcgaaatttataat
cacaagcaacttgctgacgatttagcagaaccttatccatttaaaactcgctcagattgc
gaagttattcttccgctttttcaacaaaaaggtgtgagttttgttgatgaattagaaggc
atgttctcgtttgtgctttatgacgaagaacaagatgcttatctaattgctcgtgaccat
atgggtattattcctctatacacaggttacgatgagcatggcaacttctacgttgcttca
gaaatgaaagcgttagcgcctatttgtaaaaccattagcgaatttcctcctgggcattat
ctttggagtaaagacggtcagatcacgaaatactacaaacgtgattggatggaatacgat
gcagtaaaagacaacaccactaatcttgacgatttacgtgtagcgtttgaaaaatcagtg
aaatctcacatgatgtctgacgtaccttatgcggtattgttatcgggtggtcttgactca
tcattagtctctgcgattgcggcaaaatatgttgctaaacgtgttgaagacgaagataaa
acagaagcatggtggcctcgcctacatagcttcgcggtaggccttgaaggtgcacccgat
ttgaaagctgcgaagaaagtggctgatatgattggtacggtacaccacgaaattcacttc
accatacaagaaggccttgatgccattcgtgacgtgattttccacctagaaacttatgac
accaccaccattcgtgcggcaacgccaatgtatttaatgacccgtaagattaaagccatg
ggcattaaaatggtattgtctggtgaaggcgccgatgaaatttttggtgggtacttgtac
ttccacaaagcaccaaatgcgaaagaattccacgaagaaacagtacgtaaactagatcgt
cttcacttgttcgattgtgctcgtgcgaacaaggcaacttcagcatggggtgttgaagcc
cgtgttccattcctagataaaaactttatcgacgtggccatgcgcttaaacccacaagat
aaaatgtgtcttgatggtaaaatggaaaaatggattttacgtaaagcgttcgacaacggc
gatactctgcctgctgaagtgctatggcgtcaaaaagaacagttcggtgatggcgtaggc
tattcttggattgattctatccgtgatttcgttgagaacgaagtatctgaccaacaattt
gcttctgctgagttccgcttcccagtgaacacaccagataccaaagaaggttactactac
cgtactatcttcgaaggttacttcccgcaagaaagcgctgcccgttgtgtacctagtggc
aaatctattgcctgtagtacggttgaagcgcttgagtgggatgaaagctttaagaacaat
gccgatccttcaggtcgttcaatgaaagacgtgcattcaggtgcctctgactaa

DBGET integrated database retrieval system